Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate HSERO_RS15940 HSERO_RS15940 peptide ABC transporter substrate-binding protein
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__HerbieS:HSERO_RS15940 Length = 334 Score = 270 bits (689), Expect = 5e-77 Identities = 147/321 (45%), Positives = 205/321 (63%), Gaps = 6/321 (1%) Query: 1 MMELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINR 60 M LL+V NLKV+ G++ AV GI +++ +GE L +VGESG GKS++ L+L+ L+ R Sbjct: 1 MSVLLDVKNLKVDLPTENGMLHAVRGIDFQVRRGEMLCLVGESGCGKSMTSLALMGLLPR 60 Query: 61 NGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWH 120 + +F G DL + ++L +RGK +++IFQ PMTSLNP +G Q+ E ++ Sbjct: 61 KAQCSADHILFDGVDLHGMPDKQLMQLRGKRMAMIFQEPMTSLNPSYTLGNQLCEAMLQQ 120 Query: 121 RLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADE 180 + EARERA+ LL R GI + R YP Q SGG+RQRVMIAM+L C+P L+IADE Sbjct: 121 PGVSRAEARERALYLLHRTGISNAEDRLRQYPHQLSGGLRQRVMIAMSLMCNPDLIIADE 180 Query: 181 PTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVE 240 PTTALDVTIQAQI+ +++EL++E+G +VIFITHDL V + DR+ MYAG++VE V Sbjct: 181 PTTALDVTIQAQILRMIRELQQEFGAAVIFITHDLGVVSRIADRVAVMYAGQVVETTDVA 240 Query: 241 EILKTPLHPYTKGLLNSTLEIGSR--GKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEIC 298 ++ P HPYT+GLLN G G L IPG P+ SGC F RC+ A C Sbjct: 241 QLFAQPRHPYTQGLLNCIPVRGKTLPGSHLQAIPGVVPSLVGQVSGCAFRNRCAKADSGC 300 Query: 299 QREEPPLV---NISENHRVAC 316 +R +P +V +++ H+ C Sbjct: 301 ER-DPQMVQQGSVTAPHQARC 320 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 334 Length adjustment: 28 Effective length of query: 296 Effective length of database: 306 Effective search space: 90576 Effective search space used: 90576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory