Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate HSERO_RS09190 HSERO_RS09190 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__HerbieS:HSERO_RS09190 Length = 617 Score = 266 bits (679), Expect = 1e-75 Identities = 151/321 (47%), Positives = 211/321 (65%), Gaps = 25/321 (7%) Query: 8 IKMKPLLQTVDLKK-YFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKL 66 +K++ L D+K F + ++ + AV+ +S ++ GETL +VGESGCGKST GR++L+L Sbjct: 313 LKVRDLTTRFDVKSGIFGRVRQRVHAVEKVSFDLYAGETLAIVGESGCGKSTTGRSLLRL 372 Query: 67 LRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKI 126 + GGK+ F G+D+ L E++ R+ +Q IFQDP SL+P+MTVG I +P+++H Sbjct: 373 VDIAGGKVEFGGRDLAQLPRSELRQLRRDIQFIFQDPFASLDPRMTVGYSIMEPMLVH-- 430 Query: 127 GTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSA 186 G K+ ++RV+ LL VG+ E +PHEFSGGQ+QRI IARALALNPK ++ DE VSA Sbjct: 431 GMKEGAQERVDALLTRVGLTPEHGQRYPHEFSGGQRQRICIARALALNPKIVIADESVSA 490 Query: 187 LDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFL 246 LDVSIQAQI++L+ ++Q ++GIS++FI+H++AVVE ISH+VAVMYLG+IVE G IF Sbjct: 491 LDVSIQAQIVNLMLDLQAELGISFIFISHDMAVVERISHRVAVMYLGQIVEIGPRRAIFE 550 Query: 247 NPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPI----DLPKGCRFQTRCTEKKAIC 302 NP HPYTR L+ +VP ++ L E+PSPI D PK Sbjct: 551 NPQHPYTRKLMAAVPVADPTLRQPGKKLLTDEIPSPIRRVGDEPK--------------- 595 Query: 303 FEKEPELTEVEKNHFVSCHLV 323 EP L EV HFV+ H + Sbjct: 596 --VEP-LQEVAPGHFVAQHRI 613 Score = 170 bits (430), Expect = 1e-46 Identities = 95/264 (35%), Positives = 152/264 (57%), Gaps = 13/264 (4%) Query: 13 LLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGG 72 +L L F +R + AV +S + +GETL +VGESG GKS I++L+ GG Sbjct: 7 VLDVNHLSVRFSTSERTVDAVRDLSFHVDQGETLAIVGESGSGKSVSSLAIMRLIEHGGG 66 Query: 73 KIFF----------EGKDITNLNDKEMKPYR-KKMQIIFQDPLGSLNPQMTVGRIIEDPL 121 KI + D+ ++ M+ R ++ +IFQ+P+ SLNP TVG I + + Sbjct: 67 KIASGSMQFLRRSGQRLDLAQADNATMRSIRGAEIAMIFQEPMTSLNPVFTVGEQIAESI 126 Query: 122 IIHKIGTKKERRKRVEELLDMVGI--GREFINSFPHEFSGGQQQRIGIARALALNPKFIV 179 +H+ + + +L+MV I + + PH+ SGG +QR+ IA AL+ P ++ Sbjct: 127 RLHQGLGRAAAQAEALRMLEMVRIPEAKRVLGRHPHQLSGGMRQRVMIAMALSCKPSLLI 186 Query: 180 CDEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYG 239 DEP +ALDV+IQAQI+ L+ +QQ+M + +FI H++ VV ++ +V VM G+ VE Sbjct: 187 ADEPTTALDVTIQAQILQLIRSLQQEMQMGVIFITHDMGVVAEVADRVVVMCRGEKVEEN 246 Query: 240 DVDKIFLNPIHPYTRALLKSVPKI 263 V+ +F P HPYT++LL +VP++ Sbjct: 247 AVNPLFAAPAHPYTQSLLAAVPRL 270 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 617 Length adjustment: 33 Effective length of query: 295 Effective length of database: 584 Effective search space: 172280 Effective search space used: 172280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory