Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate HSERO_RS15935 HSERO_RS15935 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__HerbieS:HSERO_RS15935 Length = 280 Score = 231 bits (588), Expect = 2e-65 Identities = 119/258 (46%), Positives = 171/258 (66%), Gaps = 3/258 (1%) Query: 2 PFDQGGIKMKPLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGR 61 P D +++ L + LK+ Q LKAV+ +S+ + GETLGLVGESGCGKSTL + Sbjct: 10 PLDDIALELCALTKVYPLKRGLFQPPGQLKAVNDVSLRLYRGETLGLVGESGCGKSTLAK 69 Query: 62 TILKLLRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPL 121 +L LL P G + G+++ + E K + + +Q IFQDP SLNP+ TV I+ PL Sbjct: 70 MLLGLLPPTSGNVLINGQEV---DPTERKAHARHIQPIFQDPYSSLNPRKTVAEIVGLPL 126 Query: 122 IIHKIGTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCD 181 +H IG ER ++V+++LD+VG+ +P++ SGGQ+QR+ IARAL L P ++CD Sbjct: 127 KLHGIGNAAERNRQVKDILDLVGMPERTHAQYPNQLSGGQRQRVAIARALILRPDILICD 186 Query: 182 EPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDV 241 EP SALDVS+QAQI++LL +++ + G++YLFI+H+L VVEH+ +VAVM G IVE Sbjct: 187 EPTSALDVSVQAQILNLLLDLKAEFGLTYLFISHDLGVVEHLVDRVAVMNQGSIVELQSR 246 Query: 242 DKIFLNPIHPYTRALLKS 259 +++F P H YTR LL S Sbjct: 247 EQLFSEPQHLYTRMLLAS 264 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 280 Length adjustment: 27 Effective length of query: 301 Effective length of database: 253 Effective search space: 76153 Effective search space used: 76153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory