Align Inositol transport system permease protein (characterized)
to candidate HSERO_RS12115 HSERO_RS12115 ATPase
Query= reanno::Phaeo:GFF716 (373 letters) >FitnessBrowser__HerbieS:HSERO_RS12115 Length = 379 Score = 400 bits (1027), Expect = e-116 Identities = 202/361 (55%), Positives = 254/361 (70%), Gaps = 5/361 (1%) Query: 11 DERIKTRSKFREAMIRPELGGIIGTITVFAMFLIFAGDSGMFNSQGVMNWSQISAQFMII 70 DER++ + + RPE + G I VF +F + AGDSGMFN GV+NW Q++A II Sbjct: 20 DERMRRENLVSRLLGRPEFASLAGVILVFLVFGLTAGDSGMFNLDGVVNWMQVAAYLGII 79 Query: 71 AVGACLLMIAGEFDLSVGSMIGFAGMLIAIFSVTLGWPVWLAILVTFAIATAIGALNGFI 130 AV ACLLMI GEFDLS+GSMIG AGM++AI +V GWP WLA+L FA + +G LNG++ Sbjct: 80 AVAACLLMIGGEFDLSIGSMIGLAGMMVAIPTVYFGWPFWLAVLFAFAASMGLGWLNGYL 139 Query: 131 VVRTGLPSFIVTLAFLFILRGFAIYLPQTIERKTIIGGVADAAEGDWLAAL-FGGKILTG 189 V++T LPSFIVTLAFLFILRG + L +TI+ GV + A DWL L F G + G Sbjct: 140 VMKTRLPSFIVTLAFLFILRGLTLALSILFANRTIVSGVGERAAHDWLGQLLFSGNVGAG 199 Query: 190 LFQWFGDNGWIAVFERGTRKGQPVVEGLPMLIVWAILLVIIGHVILTKTRFGNWIFAAGG 249 LF W +GWIA GT P+V G+P +I+W ++ + +L +TR GNWIFA GG Sbjct: 200 LFSWLARHGWIATVADGT----PLVTGIPKVILWWAVVALAASFVLARTRLGNWIFAVGG 255 Query: 250 DAEAARNSGVPVNRVKILMFMFTAFCATVFATCQVMEFGGAGSDRGLLKEFEAIIAVVIG 309 DA AA+N GVPV +VKI +F+FTAFCA +FA QV +FG A +DRGL KEFEAIIA VIG Sbjct: 256 DAVAAKNMGVPVRKVKIGLFVFTAFCACLFAVLQVGDFGSAAADRGLQKEFEAIIAAVIG 315 Query: 310 GALLTGGYGSVLGAALGALIFGVVQQGLFFAGVESSLFRVFLGLILLFAVILNTYIRRVI 369 GALLTGGYGSV+GA GALIFGVVQ G+ + + S FRVFLG++LL AV+ N ++RR I Sbjct: 316 GALLTGGYGSVIGACFGALIFGVVQIGITYTNLSSDWFRVFLGVMLLVAVLFNNFVRRRI 375 Query: 370 T 370 T Sbjct: 376 T 376 Lambda K H 0.330 0.145 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 37 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 379 Length adjustment: 30 Effective length of query: 343 Effective length of database: 349 Effective search space: 119707 Effective search space used: 119707 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory