Align Inositol transport system permease protein (characterized)
to candidate HSERO_RS03645 HSERO_RS03645 ribose ABC transporter permease
Query= reanno::WCS417:GFF2333 (340 letters) >FitnessBrowser__HerbieS:HSERO_RS03645 Length = 339 Score = 210 bits (535), Expect = 4e-59 Identities = 133/323 (41%), Positives = 198/323 (61%), Gaps = 26/323 (8%) Query: 20 LPTELSIFLVLIGIGLVFELFGWIVRDQSFLMNSQRLVLMILQVSIIGLLAIGVTQVIIT 79 LP + ++L+ G+ L G S +++ + ++ QV+I +LA G+T VI+T Sbjct: 30 LPVLVVLYLLFYGLTLYLSGDG-----TSNFASAENTMNILRQVAINLVLAAGMTFVILT 84 Query: 80 TGIDLSSGSVLALSAMIAASLAQTSDFSRAVFPSLTDLPVWIPVAMGLGVGLLAGAINGS 139 GIDLS GSVLA+SA++ + SL P W + M + GL+ G +NG+ Sbjct: 85 AGIDLSVGSVLAVSAVLGMQV------------SLGAAPGWA-IPMFIFSGLVMGMVNGA 131 Query: 140 IIAVTGIPPFIATLGMMVSARGLARYYTEGQPVSMLSD--SYTAIGHGA---MPVIIFLV 194 ++A+ I F+ TLG M + RG A +G V + +D S+ IG+G +P +I++ Sbjct: 132 MVALLNINAFVVTLGTMTAFRGAAYLLADGTTV-LNNDIPSFEWIGNGDFLHVPWLIWVA 190 Query: 195 VAVIF--HIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLIIVYSIAGLLAGLAGVVAS 252 VAV+ + LR T G + YAIGGN+QAAR +GI V L+ VYSI+GL +GLAG +++ Sbjct: 191 VAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSA 250 Query: 253 ARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFVGVDA 312 +R G YELDAIAA V+GGTSL GGVG I GTV+GALI+GVM +G T +G+ + Sbjct: 251 SRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSS 310 Query: 313 YIQDIIKGLIIVVAVVIDQYRNK 335 + Q + KG +IV+AV++D++R K Sbjct: 311 FWQYVAKGAVIVLAVILDKWRQK 333 Lambda K H 0.325 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 339 Length adjustment: 28 Effective length of query: 312 Effective length of database: 311 Effective search space: 97032 Effective search space used: 97032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory