Align m-Inositol ABC transporter, permease component (iatP) (characterized)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21390 (340 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 213 bits (543), Expect = 4e-60 Identities = 123/321 (38%), Positives = 195/321 (60%), Gaps = 19/321 (5%) Query: 14 AKSRRRLPTELSIFLVLIGIGLVFEMFGWIVRDQSFLMNSQRLVLMILQVSIIGLLAIGV 73 A +R R + L L G+ +V + G + D F +++ VL QVSI+G+LA+G+ Sbjct: 17 ASARWRSLIHSPLALPLAGLVVVSLLMG-LASDNFFTLSNWFNVLR--QVSIVGILAVGM 73 Query: 74 TQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVWIPVIAGLGVGLLA 133 + VI+T GIDLS G+ +AL+ I+A L S LP + ++ G+G+ Sbjct: 74 SFVILTGGIDLSVGAAMALAGTISAGLIVNSG-----------LPAPLALLCGVGLATCI 122 Query: 134 GAINGSIIAVTGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTAIGHGAM-----P 188 G +NG+++A +P I TL M ARG+ Y+ G P+S L + G G + P Sbjct: 123 GLLNGALVAWGRMPAIIVTLATMGVARGVGLIYSGGYPISGLPGWISWFGVGRIGMVPVP 182 Query: 189 VIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIAGLLAGLAG 248 VI+ L+V + + L+ T +G++ YAIGGN AAR SG+ R + VY+I+G +GLA Sbjct: 183 VILMLIVYALAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYAISGFTSGLAA 242 Query: 249 VVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFV 308 ++ + R +GQ G+ +ELDAIAA V+GGT++AGG G + GT+IGA++LG++ +G + Sbjct: 243 IILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLLGILNNGLNLM 302 Query: 309 GVDAYIQDIIKGLIIVIAVVI 329 G++ Y+QDII+G+II++A+ I Sbjct: 303 GINPYLQDIIRGVIILLAIYI 323 Lambda K H 0.326 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 328 Length adjustment: 28 Effective length of query: 312 Effective length of database: 300 Effective search space: 93600 Effective search space used: 93600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory