Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= TCDB::B8H230 (332 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 229 bits (584), Expect = 7e-65 Identities = 125/290 (43%), Positives = 184/290 (63%), Gaps = 4/290 (1%) Query: 32 LLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDVAVGSLLAFASI 91 L+++ + G A++ F T N N+L +VSI GI+AVGM+FVIL GGID++VG+ +A A Sbjct: 36 LVVVSLLMGLASDNFFTLSNWFNVLRQVSIVGILAVGMSFVILTGGIDLSVGAAMALAGT 95 Query: 92 AAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGMTVWRGA 151 +A ++ P L + ++T IGL + G V W +PA IVTL M V RG Sbjct: 96 ISAGLIVNSGLPAPLALLCGVGLATCIGL----LNGALVAWGRMPAIIVTLATMGVARGV 151 Query: 152 TLLLNDGGPISGFNDAYRWWGSGEILFLPVPVVIFALVAAAGHVALRYTRYGRQVYAVGG 211 L+ + G PISG W+G G I +PVPV++ +V A + L+ T +GR VYA+GG Sbjct: 152 GLIYSGGYPISGLPGWISWFGVGRIGMVPVPVILMLIVYALAWLLLQRTAFGRHVYAIGG 211 Query: 212 NAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAVAGTGYELRVIASVVIG 271 N AARLSGV I +VYAI G +GL+ +L+ RL S + AG G+EL IA+VV+G Sbjct: 212 NEMAARLSGVKTTRIKLAVYAISGFTSGLAAIILTGRLMSGQPNAGVGFELDAIAAVVLG 271 Query: 272 GASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGLIIVAAV 321 G ++ GG G V GT++GA+L+G+L+NGL ++ + Y+Q ++ G+II+ A+ Sbjct: 272 GTAIAGGRGLVVGTLIGAVLLGILNNGLNLMGINPYLQDIIRGVIILLAI 321 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 328 Length adjustment: 28 Effective length of query: 304 Effective length of database: 300 Effective search space: 91200 Effective search space used: 91200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory