Align 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92); possible 5-dehydro-2-deoxyphosphogluconate aldolase DUF2090 (EC 4.1.2.29) (characterized)
to candidate HSERO_RS07545 HSERO_RS07545 2-dehydro-3-deoxygluconokinase
Query= reanno::Caulo:CCNA_01356 (642 letters) >FitnessBrowser__HerbieS:HSERO_RS07545 Length = 313 Score = 110 bits (274), Expect = 1e-28 Identities = 99/329 (30%), Positives = 147/329 (44%), Gaps = 28/329 (8%) Query: 8 LDLIAVGRSSVDLYGQQVGGRLEDMGSFAKYLGGSPTNTAAGGARLGLKTGLLTRVGADH 67 LD++ G + L +VG E++ + + L G+ TN A G ARLGLK G +RVG D Sbjct: 5 LDVVTWGEALALLVADEVGP-FEEVEKYTRRLAGAETNVAIGLARLGLKVGWASRVGNDA 63 Query: 68 MGRFIREQLEREGVDVAGVLSDPDRLTALVILGIRDRVNFPLI-FYRENCADMALEPSDV 126 GRFIR+++ +EGV+V+ V++D + TA+ + P I +YR+ A L D Sbjct: 64 FGRFIRQRVAQEGVEVSRVITDMEFRTAIQLKAKAVGGADPAIEYYRKGSAASHLSVDDF 123 Query: 127 DEAWFAQAGAVLINGTHLSQPNVYETSL----KAARAVKAAGGRVAFDIDYRPVLWGLTG 182 D +F A + G P + T++ +A ++ G ++FD + RP+LW Sbjct: 124 DAGYFGAARHLHATGI---APALSATTMAFAHQAMDFMRGQGKTISFDPNLRPMLW---- 176 Query: 183 KDAGENRFVENQQVTAKLQEVVAL-CDLIVGTEEEIHILGGSTDTIAALRAIRRASDALL 241 +Q+V A+ +A D ++ E IL G D L+ Sbjct: 177 ---------PSQEVMAQQLNALAFKADWVLPGLSEGKILTGHDDAREIAGFYLERGVKLV 227 Query: 242 VCKRGPEGCVAFPGAIPDALDEGVSARGFKVEVFNVLGAGDAFMAGFLRGWLRHESVETC 301 V K G EG G EG A EV + +GAGD F G + G L V Sbjct: 228 VIKLGAEGAYWRNGQ-----GEGRVAGVPVKEVVDTVGAGDGFAVGVISGMLEGLPVPQA 282 Query: 302 CEWGNACGAIVVSRHGCTPAMPTWIELQA 330 GN GA + G +PT EL+A Sbjct: 283 VMRGNRIGAFAIQVVGDMEGLPTRAELEA 311 Lambda K H 0.322 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 642 Length of database: 313 Length adjustment: 32 Effective length of query: 610 Effective length of database: 281 Effective search space: 171410 Effective search space used: 171410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory