Align inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate HSERO_RS12100 HSERO_RS12100 oxidoreductase
Query= BRENDA::E1U888 (350 letters) >FitnessBrowser__HerbieS:HSERO_RS12100 Length = 341 Score = 241 bits (614), Expect = 3e-68 Identities = 125/338 (36%), Positives = 204/338 (60%), Gaps = 3/338 (0%) Query: 5 TIKIGIVGLGRLGKIHATNIATKIQHAKLQAATSVVPAELDWAKKELGVEEVFEDFDDMV 64 ++++G+VGLGR+G+ HA NIA A L A S + E DWA++ L E +ED+ ++ Sbjct: 6 SLQVGLVGLGRMGRRHAENIAFNTPGATLCAVCSPLAQERDWAQQHLPSAERYEDYQALL 65 Query: 65 QHADIDAVFIVSPSGFHLQQIESALNAGKHVFSEKPIGLDIEAIEHTQQVIAQHANLKFQ 124 +H +DAVF+V+P+ H +QI +AL AGKHVF EKP+ LD+E + A+H LK Sbjct: 66 RHPGLDAVFLVTPTALHGEQIIAALRAGKHVFCEKPLSLDLEECQRVAAEAARHPQLKVM 125 Query: 125 LGFMRRFDDSYRYAKQLVDQGKIGDITLIRSYSIDPAAGMASFVKFATSANSGGLFLDMS 184 +GF+RRFD SY+ A + + +G IG ++ S + D FV+FA A+SGGLFLD S Sbjct: 126 IGFVRRFDASYQDAHRKISEGLIGAPFMVYSQTADALDPDGFFVRFA--ASSGGLFLDCS 183 Query: 185 IHDIDVIHWFTGKEID-KVWAIGLNRAYPVLDKAGELETGAALMQLEDKTMAILVAGRNA 243 +HDID+ W G + +V A G+ + L+ +++ G A+ + +A A R Sbjct: 184 VHDIDLARWLLGADQPVRVMASGVRAVHHELEAFQDIDNGVAICEFAQGRLATFYASRTM 243 Query: 244 AHGYHVETEIIGTKGMLRIAQVPEKNLVTVMNEEGIIRPTSQNFPERFAQAFLSEEQAFV 303 AHG+ TEI+GT+G L + P N +T+ + G+ + +F ERFA+AF++E + FV Sbjct: 244 AHGHETMTEIVGTRGRLSVGANPSLNRLTIADAHGLRNECTPSFIERFAEAFVAEVRHFV 303 Query: 304 NSILNNQDVGITAEDGLQGTKAALALQEAFEKNDIVQV 341 +++ + + +T +D ++ T+ A A++++ + VQ+ Sbjct: 304 DAVRYDTPLALTLQDAIEATRIAAAMRQSLLEQQPVQL 341 Lambda K H 0.318 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 341 Length adjustment: 29 Effective length of query: 321 Effective length of database: 312 Effective search space: 100152 Effective search space used: 100152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory