Align BadI (characterized)
to candidate HSERO_RS18840 HSERO_RS18840 enoyl-CoA hydratase
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__HerbieS:HSERO_RS18840 Length = 263 Score = 89.0 bits (219), Expect = 9e-23 Identities = 77/254 (30%), Positives = 111/254 (43%), Gaps = 13/254 (5%) Query: 9 EIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFCTGGD- 67 E + G+ + +NRP NA L L D V ++LA G +AFC G D Sbjct: 12 EDQQGITTLTLNRPQHFNALSEEMLTALQAQLDDIKSDSTVRCVILAANG-KAFCAGHDL 70 Query: 68 ---QSTHDGNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDLTICS 124 Q+T Y + L ++R++P PVIA+VQG A G L CDL I + Sbjct: 71 RQMQATPQQTY--YEALFHRCSHLMQSLRELPVPVIAKVQGLATAAGCQLVATCDLAIAA 128 Query: 125 EKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANLCVPH 184 E A F G +G A L R + K+A E+ K A A GL N VP Sbjct: 129 ESARFAVSGINVGLFCSTPAVA-LTRNLPIKRAFEMLVTGKFIDAATAAAWGLINQAVPE 187 Query: 185 DELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLY---YDTDESR 241 ELD+ Q E+C S A++IA+ + + +A ++ E++ Sbjct: 188 QELDSATQALAREIC--SKPAISIARGKAMVYRQQMMALPDAYAHAAEVMACNIMDPEAQ 245 Query: 242 EGVKALQEKRKPEF 255 EG+ A +KRKP + Sbjct: 246 EGITAFLDKRKPNW 259 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 263 Length adjustment: 25 Effective length of query: 235 Effective length of database: 238 Effective search space: 55930 Effective search space used: 55930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory