Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate HSERO_RS08335 HSERO_RS08335 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::psRCH2:GFF3449 (361 letters) >FitnessBrowser__HerbieS:HSERO_RS08335 Length = 364 Score = 441 bits (1135), Expect = e-128 Identities = 228/349 (65%), Positives = 262/349 (75%), Gaps = 5/349 (1%) Query: 11 NPIGTDGFEFVEFTAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLFQQHDINIVLNGSP 70 NP+GTDGFEFVE+TA + I ++ L MGFT A+HRSK V L++Q +N +LNG P Sbjct: 19 NPMGTDGFEFVEYTAADPAAIARVLEL---MGFTAVARHRSKNVTLYRQGQVNFILNGEP 75 Query: 71 TGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFGELNIPCVEGIGGS 130 + AFA+ HG S AMAFRVK+AAQ GA+ V + ELNIP + GIGGS Sbjct: 76 GSNAAAFAQVHGASVNAMAFRVKDAAQVYKRALELGAEGVEAKLGPMELNIPAIRGIGGS 135 Query: 131 LLYLVDRYGDK-SIYDVDFEYIEGRTPNDNAVGLMCIDHLTHNVMRGQMDVWSGFYERIA 189 LLYLVDRYG+ SIYDVDF++ G N VGL IDHLTHNVMRG MD WS FY R+ Sbjct: 136 LLYLVDRYGENGSIYDVDFQFFPGVERNPKGVGLTYIDHLTHNVMRGAMDTWSSFYTRLF 195 Query: 190 NFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDKSQIEEFIREYHGEGIQHIAL 249 NFREI+YFDIEGK+TGL SRAMT+PCGKIRIPINESADDKSQIEEFI++Y+GEGIQHIAL Sbjct: 196 NFREIKYFDIEGKVTGLRSRAMTSPCGKIRIPINESADDKSQIEEFIKQYNGEGIQHIAL 255 Query: 250 STDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLRELNILIDGAP-GDDG 308 TDDIY TVR LR GV T TYY+ V+ R+ GHGE D LREL ILIDGAP G Sbjct: 256 GTDDIYQTVRALRERGVPLQDTISTYYDLVERRIPGHGEDLDALRELKILIDGAPTAGQG 315 Query: 309 ILLQIFTNTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQLRRGVI 357 +LLQIFT +IGP+F+EIIQRKGN GFGEGNFKALFESIE DQ+RRGVI Sbjct: 316 LLLQIFTQNLIGPVFYEIIQRKGNDGFGEGNFKALFESIELDQMRRGVI 364 Lambda K H 0.320 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 364 Length adjustment: 29 Effective length of query: 332 Effective length of database: 335 Effective search space: 111220 Effective search space used: 111220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS08335 HSERO_RS08335 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.16239.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-131 424.0 0.0 3.5e-131 423.8 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS08335 HSERO_RS08335 4-hydroxyphenylpyr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS08335 HSERO_RS08335 4-hydroxyphenylpyruvate dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.8 0.0 3.5e-131 3.5e-131 2 352 .. 25 363 .. 24 364 .] 0.98 Alignments for each domain: == domain 1 score: 423.8 bits; conditional E-value: 3.5e-131 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflakH 69 gf+fve++++d+ a +++ e +Gf+ava+ +r+k++t++rqg+++++l+ e+ s+ aaaf++ H lcl|FitnessBrowser__HerbieS:HSERO_RS08335 25 GFEFVEYTAADPA-AIARVLELMGFTAVAR---HRSKNVTLYRQGQVNFILNGEPGSN--AAAFAQVH 86 8************.999999*********8...*************************..******** PP TIGR01263 70 GdgvkdvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlveregekgsilpg 137 G +v+++af+v+d+++++++a+e gae v+a+ +e++++ai+giG+++l+lv+r+ge+gsi+++ lcl|FitnessBrowser__HerbieS:HSERO_RS08335 87 GASVNAMAFRVKDAAQVYKRALELGAEGVEAKLG--PMELNIPAIRGIGGSLLYLVDRYGENGSIYDV 152 *******************************996..99****************************** PP TIGR01263 138 feevsekaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkSkvla 205 ++++ +++++++vgl++iDH+++nv rg ++++++fy ++++f+eik+fdi++++++L+S++++ lcl|FitnessBrowser__HerbieS:HSERO_RS08335 153 DFQFFPG--VERNPKGVGLTYIDHLTHNVMRGAMDTWSSFYTRLFNFREIKYFDIEGKVTGLRSRAMT 218 ***9997..566679***************************************************** PP TIGR01263 206 saegkvklplnepaskkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflkipetYYdn 273 s++gk+++p+ne s ++ksQIee++++y+G+G+QH+Al t+di++tv++lr+rgv + ++ +tYYd lcl|FitnessBrowser__HerbieS:HSERO_RS08335 219 SPCGKIRIPINE--SADDKSQIEEFIKQYNGEGIQHIALGTDDIYQTVRALRERGVPLQDTISTYYDL 284 ************..89**************************************************** PP TIGR01263 274 lkervkklvkedleelkelkiLvDrd...eeGlLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfka 338 +++r++ + edl+ l+elkiL+D++ +GlLLQiFt++++ g++F+EiIqRkg++GFGegNfka lcl|FitnessBrowser__HerbieS:HSERO_RS08335 285 VERRIPG-HGEDLDALRELKILIDGAptaGQGLLLQIFTQNLI--GPVFYEIIQRKGNDGFGEGNFKA 349 ******7.*****************9988899***********..*********************** PP TIGR01263 339 LfeaiEreqekrgv 352 Lfe+iE +q +rgv lcl|FitnessBrowser__HerbieS:HSERO_RS08335 350 LFESIELDQMRRGV 363 ************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.90 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory