Align Phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate HSERO_RS21390 HSERO_RS21390 phenylalanine 4-monooxygenase
Query= reanno::acidovorax_3H11:Ac3H11_1847 (290 letters) >FitnessBrowser__HerbieS:HSERO_RS21390 Length = 295 Score = 323 bits (828), Expect = 3e-93 Identities = 153/249 (61%), Positives = 187/249 (75%) Query: 27 RGDYSRANADYTCPQDYAAYTDADHDTYRRLYERQRALLPGLASQAFIDALPSLGASDQI 86 RGDYS+A+A+Y Q++ YT A H +RRLYERQ L+PG A FI++L +L S I Sbjct: 24 RGDYSQADANYVVAQNWEGYTPAQHALWRRLYERQARLIPGRACDVFIESLKALDVSQGI 83 Query: 87 PRFEEVNERLYKATGWELVGVPGLIPEVPFFTLLANRQFPVTDWIRKPEEFEYIVEPDIF 146 PRF+ + LYKATGW+LV VPGL+P+ FF LANR+FPVT W+R+ EF+YIVEPD+F Sbjct: 84 PRFDRTTDALYKATGWQLVAVPGLVPDQTFFEHLANRRFPVTVWLREEHEFDYIVEPDLF 143 Query: 147 HDLFGHVPLLFNPVFADYVQRYGQGGLKAQGLGSCEMLSRLYWYTIEFGLIREAGELRAY 206 HD FGHVPLLFNPVFA+++Q YG+GGLKA L L+RLYWYTIEFGLI+ LR Y Sbjct: 144 HDFFGHVPLLFNPVFANHLQEYGKGGLKALKLDGLAYLARLYWYTIEFGLIQSEAGLRIY 203 Query: 207 GAGILSSSGELAYSVQSPEPQRIPLALERTMRTRYKIDTYQQTYFVIDSFEQLFEMTAAD 266 GAGILSS GE+ Y + S +P+R+P +ER MRT YKIDTYQ+TYFVI FEQLF TA D Sbjct: 204 GAGILSSGGEVEYCLSSDKPRRVPFQVERIMRTLYKIDTYQETYFVIRDFEQLFNDTAPD 263 Query: 267 FAPIYERLR 275 F P YERL+ Sbjct: 264 FTPFYERLK 272 Lambda K H 0.321 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 295 Length adjustment: 26 Effective length of query: 264 Effective length of database: 269 Effective search space: 71016 Effective search space used: 71016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate HSERO_RS21390 HSERO_RS21390 (phenylalanine 4-monooxygenase)
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01267.hmm # target sequence database: /tmp/gapView.2067878.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-107 342.1 0.1 9.4e-107 341.8 0.1 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS21390 HSERO_RS21390 phenylalanine 4-mo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS21390 HSERO_RS21390 phenylalanine 4-monooxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 341.8 0.1 9.4e-107 9.4e-107 2 245 .. 34 277 .. 33 280 .. 0.98 Alignments for each domain: == domain 1 score: 341.8 bits; conditional E-value: 9.4e-107 TIGR01267 2 ftvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklraltGwk 69 + vaq+++ y+ +ha w+ l++rq++l++gracd +++ ++ l++ + ip ++ ++ l ++tGw+ lcl|FitnessBrowser__HerbieS:HSERO_RS21390 34 YVVAQNWEGYTPAQHALWRRLYERQARLIPGRACDVFIESLKALDV-SQGIPRFDRTTDALYKATGWQ 100 56899*****************************************.899****************** PP TIGR01267 70 ivavpglipadvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadfleayGkk 137 +vavpgl+p+++ffehlanrrfpvt +lr+ +e+dy++epd+fhd+fGhvpll npvfa++l+ yGk+ lcl|FitnessBrowser__HerbieS:HSERO_RS21390 101 LVAVPGLVPDQTFFEHLANRRFPVTVWLREEHEFDYIVEPDLFHDFFGHVPLLFNPVFANHLQEYGKG 168 ******************************************************************** PP TIGR01267 138 gvkakalgaa.llarlywytvefGlvetaaglriyGaGilsskkelvyaleskeplrvafdllevmrt 204 g+ka +l++ larlywyt+efGl++ +aglriyGaGilss e+ y+l s++p+rv+f+++++mrt lcl|FitnessBrowser__HerbieS:HSERO_RS21390 169 GLKALKLDGLaYLARLYWYTIEFGLIQSEAGLRIYGAGILSSGGEVEYCLSSDKPRRVPFQVERIMRT 236 ******998769******************************************************** PP TIGR01267 205 ryridklqkayfvlpslkrlfdaaqedfealvaeakdlkal 245 y+id++q++yfv+ ++++lf+ +++df++++ ++k++++l lcl|FitnessBrowser__HerbieS:HSERO_RS21390 237 LYKIDTYQETYFVIRDFEQLFNDTAPDFTPFYERLKQQEPL 277 ************************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 20.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory