Align flavohemoprotein; EC 1.14.12.17 (characterized)
to candidate HSERO_RS12535 HSERO_RS12535 dihydropteridine reductase
Query= CharProtDB::CH_003330 (396 letters) >FitnessBrowser__HerbieS:HSERO_RS12535 Length = 397 Score = 271 bits (694), Expect = 2e-77 Identities = 158/400 (39%), Positives = 226/400 (56%), Gaps = 17/400 (4%) Query: 1 MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQREALFNA 60 + DAQ +A VK+T+PLL G LT HFY + P+++ +FN ++Q +GDQ AL N Sbjct: 2 LTDAQ-LAIVKSTVPLLESGGEALTTHFYKMLMRDYPQVRPLFNRAHQASGDQPRALANG 60 Query: 61 IAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFS---PGQEVL 117 + YA +I+ L L P +I KH + Q+ PE Y +VG+ LL + E+ V+ Sbjct: 61 VLMYARHIDRLEELGPLAAQIINKHVAVQVLPEHYPMVGDCLLRAIREVLGAEIATDAVI 120 Query: 118 DAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFELEPVDG 177 DAW AYG LA++ I E + Y A GGW G R+F + K S ITSF P DG Sbjct: 121 DAWAAAYGQLADILIGAERQQYEAKAQAPGGWSGARNFIVSRKVAESEEITSFHFVPQDG 180 Query: 178 GAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPDGKG----YRIAVKREEGGQVSNWL 233 G + ++ PGQY+G+ + +G ++ RQYSL+ G YRI+VKRE GG+VS L Sbjct: 181 GELLDFAPGQYIGLRMVVDG--EEQRRQYSLSALLRQAGQPPQYRISVKREPGGKVSRQL 238 Query: 234 HNHANVGDVVKLVAPAGDFFMAVADDTPVTLISAGVGQTPMLAMLDTLAKAGHTAQVNWF 293 H+ +VG VV+L PAG+F + +A D P+ LIS GVG TPM++ML +G +++ Sbjct: 239 HDQIHVGSVVELFPPAGEFTL-MASDKPLALISGGVGITPMMSMLAAALPSGR--PIHFI 295 Query: 294 HAAENGDVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGLMDLSKLEGAF- 352 HAA +G VHAF +++EL P+ Y QP + D A + GL++ S L+ Sbjct: 296 HAARHGGVHAFRRQLEELAARHPQLQLRFCYEQPRQGDAAP---HATGLIERSLLQQWLP 352 Query: 353 SDPTMQFYLCGPVGFMQFTAKQLVDLGVKQENIHYECFGP 392 +P + Y GP FM+ +QL +LGV YE FGP Sbjct: 353 GNPDLDAYFVGPKSFMKAIKRQLAELGVPAAQSRYEFFGP 392 Lambda K H 0.318 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 397 Length adjustment: 31 Effective length of query: 365 Effective length of database: 366 Effective search space: 133590 Effective search space used: 133590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory