Align BadK (characterized)
to candidate HSERO_RS20665 HSERO_RS20665 2,3-dehydroadipyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__HerbieS:HSERO_RS20665 Length = 262 Score = 196 bits (498), Expect = 4e-55 Identities = 114/244 (46%), Positives = 149/244 (61%), Gaps = 5/244 (2%) Query: 17 ITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIASMAAWSYS 76 +TLNRP + NAL + + + AL + DD + +VI+GN +AFAAGAD+ M + Sbjct: 22 LTLNRPALRNALRNQSLREIVAALARAEEDDSVRVVVISGNEKAFAAGADLNEMI---HK 78 Query: 77 DVYGSNFITRN--WETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKFALPEIK 134 D + R W I + KP+LAAV G A G GCEL + DI IA R AK PEI Sbjct: 79 DAIATQLDVRAQYWRAIARFPKPILAAVNGYALGAGCELLMHADIAIAARGAKIGQPEIN 138 Query: 135 LGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRLRDETVALA 194 +G LPGAGGTQRL R +GK AM M LS ++A++A + GLV+ VVDDD + T+ALA Sbjct: 139 VGTLPGAGGTQRLIRTVGKPLAMKMVLSGEFISADQALQAGLVAEVVDDDATLERTLALA 198 Query: 195 TTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFLEKRAPC 254 +IA S A+ KE++ ++FE L G+LFER+ ASAD +EGI AF EKRA Sbjct: 199 HSIAQKSPLAVRLAKEAMLQSFELGLEAGLLFERKSFSLMAASADRQEGIAAFQEKRAAV 258 Query: 255 FSHR 258 FS R Sbjct: 259 FSGR 262 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory