Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate HSERO_RS00890 HSERO_RS00890 ABC transporter ATP-binding protein
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__HerbieS:HSERO_RS00890 Length = 404 Score = 243 bits (619), Expect = 1e-68 Identities = 145/347 (41%), Positives = 198/347 (57%), Gaps = 60/347 (17%) Query: 171 QLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLA------------ 218 +++D+ +L YIML GLN+VVG AGLLDLGY+AFYA+GAYS LLA Sbjct: 42 RIMDVALL---YIMLALGLNVVVGFAGLLDLGYIAFYAIGAYSAGLLASPQFAAVIESFV 98 Query: 219 --------------------HYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIV 258 + S W+ +P++ FLAA+ G LLG P L+LRGDY AIV Sbjct: 99 NTYPSVGNFLVWLCGPEIVQNGIHLSLWLIVPISAFLAALFGALLGAPTLKLRGDYLAIV 158 Query: 259 TLGFGEIIRIILINW---YQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLE 315 TLGFGEIIRI + N T GP GI+ I FG+ + G+ + ++FG+ Sbjct: 159 TLGFGEIIRIFMNNLNAPVNITNGPQGINLIDPIKVFGV---SLAGEPGSGSMVKVFGMS 215 Query: 316 FSPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLA 375 ++ Y+L L+L + V F++R++ LGRAW A+RED+IA ++GIN N+KL Sbjct: 216 MPSVNA---YYFLFLLLCIGVIFFSVRLQDSRLGRAWVAIREDEIAAKAMGINTRNVKLL 272 Query: 376 AFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIG 435 AFA+ A FGG AG+ F QGF+SPESF+ ES +LA+VVLGG+G GVV+ ++ Sbjct: 273 AFAMGASFGGVAGAMFGAFQGFVSPESFSLTESIAVLAMVVLGGIGHIPGVVLGGVILAA 332 Query: 436 LPEAFRELAD----------------YRMLAFGMGMVLIMLWRPRGL 466 LPE R + + R L +G+ MV+IML RP GL Sbjct: 333 LPEVLRHVVEPVQMAIFGKVWIDAEVLRQLLYGLAMVVIMLTRPAGL 379 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 404 Length adjustment: 33 Effective length of query: 472 Effective length of database: 371 Effective search space: 175112 Effective search space used: 175112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory