Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate HSERO_RS04640 HSERO_RS04640 butyryl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__HerbieS:HSERO_RS04640 Length = 382 Score = 206 bits (524), Expect = 9e-58 Identities = 130/378 (34%), Positives = 202/378 (53%), Gaps = 2/378 (0%) Query: 18 LADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPGL 77 L+ + M+RDA +AQ +L P + R+ T A +E+ E+G +G +PEQ+GG G+ Sbjct: 3 LSPEHEMIRDAMRHFAQERLLPFAADWDRNHTFPAEALKELAELGAMGMCVPEQWGGAGM 62 Query: 78 DYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCFG 137 DY+S L E+ D +++SVQ+SL ++GS QKE++L LA GE +GCF Sbjct: 63 DYMSLVLALEEIAAGDGATSTIVSVQNSLACGITEKYGSPTQKEQWLKPLARGEMLGCFC 122 Query: 138 LTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLDED-GRDEIRGF 196 LTEP+ GSD ++ TRA + + L+G+K +IT+ A V +V+A D G+ I F Sbjct: 123 LTEPHTGSDAAAIRTRAERDGDDFILNGTKQFITSGKHAGVAIVFAVTDRSAGKKGISCF 182 Query: 197 ILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNSARY 255 ++ G K+G AS T +I+LD VP +L +G R + L + R Sbjct: 183 LVPCDTPGFVVGRSEEKMGQHASDTVQIMLDNCRVPATALLGKEGEGYRIALSNLEAGRI 242 Query: 256 GIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGR 315 GIA ++G A + + A Y R+ FG P+ +Q + +LADM T + V R + Sbjct: 243 GIAAQSVGMARAAFEAAVSYARQRESFGVPIIEHQAVNFRLADMNTLLDAARLMVWRAAQ 302 Query: 316 MKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEG 375 +KD+G ++ S+ K + A IA A + GG G + +F V R ++ + YEG Sbjct: 303 LKDQGRPCLKEASMAKMFASEAAEKIASDAIQIHGGVGYTSDFPVERIYRDVRICQIYEG 362 Query: 376 THDIHALILGRAQTGIQA 393 +DI L++GRA QA Sbjct: 363 ANDIQRLVIGRAIASDQA 380 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 382 Length adjustment: 30 Effective length of query: 365 Effective length of database: 352 Effective search space: 128480 Effective search space used: 128480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory