Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate HSERO_RS08530 HSERO_RS08530 glycine/betaine ABC transporter permease
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__HerbieS:HSERO_RS08530 Length = 237 Score = 104 bits (260), Expect = 2e-27 Identities = 60/181 (33%), Positives = 98/181 (54%), Gaps = 2/181 (1%) Query: 149 LALVLTALLFCIVIGLPLGIWLAR--SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIG 206 L LV T++L + G+P GI L+R + R+A+ + + T P+ L + FGIG Sbjct: 45 LELVFTSMLLALATGIPAGIALSRPGAQRSAEKFIQIFNIGNTIPSIAVLALALAFFGIG 104 Query: 207 NVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMA 266 N P ++ + +L PI+R T G+ VPA + EA+R G P Q+L +V+LP A+P I+ Sbjct: 105 NGPTILALWLASLLPIVRNTYEGLKNVPAAMKEAARGIGMKPHQILLRVELPNALPIIVG 164 Query: 267 GVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQA 326 GV L + + ++ +I LG ++ GI + G +G +LA++LD L A Sbjct: 165 GVRTALAINVGTAPLSMLIGGESLGGLIFPGIYLNNHGQLLLGAAATALLALVLDALVTA 224 Query: 327 V 327 + Sbjct: 225 L 225 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 237 Length adjustment: 26 Effective length of query: 328 Effective length of database: 211 Effective search space: 69208 Effective search space used: 69208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory