Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate HSERO_RS20665 HSERO_RS20665 2,3-dehydroadipyl-CoA hydratase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__HerbieS:HSERO_RS20665 Length = 262 Score = 172 bits (436), Expect = 6e-48 Identities = 101/259 (38%), Positives = 154/259 (59%), Gaps = 5/259 (1%) Query: 3 FETIETKKEG-NLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAF 61 +E + + G ++ +TLNRP NAL + L E+ A+++AE D +RV++I+G KAF Sbjct: 7 YEDLLAARHGEHVLHLTLNRPALRNALRNQSLREIVAALARAEEDDSVRVVVISGNEKAF 66 Query: 62 CAGADITQFNQLTPAEAWKFSKKGR-EIMDKIEALSKPTIAMINGYALGGGLELALACDI 120 AGAD+ N++ +A R + I KP +A +NGYALG G EL + DI Sbjct: 67 AAGADL---NEMIHKDAIATQLDVRAQYWRAIARFPKPILAAVNGYALGAGCELLMHADI 123 Query: 121 RIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNR 180 IAA A++G PEIN+G PG GGTQRL R +GK A++M+++G+ I A + GLV Sbjct: 124 AIAARGAKIGQPEINVGTLPGAGGTQRLIRTVGKPLAMKMVLSGEFISADQALQAGLVAE 183 Query: 181 VVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTED 240 VV + T LA IA+KSP+++ L KE + + + L +GL E + ++ ++ D Sbjct: 184 VVDDDATLERTLALAHSIAQKSPLAVRLAKEAMLQSFELGLEAGLLFERKSFSLMAASAD 243 Query: 241 KKEGVSAFLEKREPTFKGK 259 ++EG++AF EKR F G+ Sbjct: 244 RQEGIAAFQEKRAAVFSGR 262 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 262 Length adjustment: 25 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory