GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Herbaspirillum seropedicae SmR1

Align Acyl-coenzyme A synthetase ACSM3, mitochondrial; Acyl-CoA synthetase medium-chain family member 3; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; Protein SA homolog; EC 6.2.1.2; EC 6.2.1.17 (characterized)
to candidate HSERO_RS04625 HSERO_RS04625 AMP-binding protein

Query= SwissProt::Q3UNX5
         (580 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS04625 HSERO_RS04625 AMP-binding
           protein
          Length = 556

 Score =  259 bits (662), Expect = 2e-73
 Identities = 170/509 (33%), Positives = 271/509 (53%), Gaps = 18/509 (3%)

Query: 74  NPAFWWIDGNGEELRWSFEELGLLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVA 133
           N A  ++  +GE  ++SF ++  ++ + AN+L +   +Q G  V  +LP+ PE     + 
Sbjct: 52  NIALEFVSLHGEHQQYSFAQVRSMAARVANLLRQQ-GIQPGQIVAGMLPRTPELLATVLG 110

Query: 134 CLRTGTVLIPGTTQLTQKDILYRLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIVSQ 193
            LR G V  P  T    K I +RL  S A  I+T+      +D +A  C  + +    + 
Sbjct: 111 TLRAGAVYQPLFTAFGPKAIEHRLALSGASLIVTNVANRDKLDEIA-NCPQVCTVRESND 169

Query: 194 HSREGWGNLKEMMKYASDSHTCVDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVN 253
             R G  + +  +   SD    V     ++M +  TSGTTG  K +    S+     SV 
Sbjct: 170 PLRAGDIDFRAAVDAQSDDFAPVLRSGADLMLMMSTSGTTGAAKGVPVPLSALQ-AFSVY 228

Query: 254 GRFWLDLIASDVMWNTSDTGWAKSAWSSVFSPWTQGACVFAHYLPRFESTSILQTLSKFP 313
            R  + L+  D  WN +D GWA   + ++  P   G  +  +    F  +   +T+ +  
Sbjct: 229 MREAVGLLPQDKFWNMADPGWAYGLYYAIIGPLAIGHGITFNEAA-FTVSGTYETIRRLG 287

Query: 314 ITVFCSAPTAYRMLVQ--NDMSSYKFNSLKHCVSAGEPINPEVMEQWRKKTGLDIYEGYG 371
           IT    APTAYRM++    + ++     L+   SAGEP+N EV+  +     + I++ YG
Sbjct: 288 ITSLAGAPTAYRMMMAAGEEAAASVKGRLRAVSSAGEPLNAEVVRWFASALDVPIHDHYG 347

Query: 372 QTETVLICGNFKGMK--IKPGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLPERPF 429
           QTE  ++  N   ++  + PGS G   P + V +LDEN   L   Q G++A+ +    P 
Sbjct: 348 QTELGMVVNNHHALRHEVVPGSAGFAMPGYRVVVLDENHQELGANQPGELAIDIA-RSPL 406

Query: 430 GLFTHY--VDNPSKTASTLRGSFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPFEV 487
             F+ Y   D P+     +   +Y TGD   ++ +G   F+ RSDD+I S+GYRIGPF+V
Sbjct: 407 YWFSGYWKQDTPA-----IAHGYYSTGDNVELEPNGSISFIGRSDDVITSAGYRIGPFDV 461

Query: 488 ESALIEHPSIAESAVVSSPDPIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTAPY 547
           ESAL+EHP++A+ AV+  PDP R E+VKAF+VL+  +K+ D   L++++ +HVK+  + +
Sbjct: 462 ESALLEHPAVADVAVIGLPDPERTEIVKAFVVLSDQFKASD--ALREQLAQHVKRRLSAH 519

Query: 548 KYPRKVEFIEELPKTVSGKVKRNELRKKE 576
            YPR +EF++ LPKT SGK++R  LRK E
Sbjct: 520 AYPRAIEFLDALPKTPSGKLQRFVLRKME 548


Lambda     K      H
   0.319    0.134    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 744
Number of extensions: 40
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 580
Length of database: 556
Length adjustment: 36
Effective length of query: 544
Effective length of database: 520
Effective search space:   282880
Effective search space used:   282880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory