GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Herbaspirillum seropedicae SmR1

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate HSERO_RS07770 HSERO_RS07770 acetyl-CoA synthetase

Query= SwissProt::P31638
         (660 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS07770 HSERO_RS07770 acetyl-CoA
           synthetase
          Length = 660

 Score = 1112 bits (2877), Expect = 0.0
 Identities = 518/657 (78%), Positives = 592/657 (90%)

Query: 4   IESVMQEHRVFNPPEGFASQAAIPSMEAYQALCDEAERDYEGFWARHARELLHWTKPFTK 63
           IE+  QE+RVF PP      AAI  M+AY AL  E  +DYEG WAR A++ L W KPFT+
Sbjct: 4   IETFKQENRVFAPPAELVKHAAISGMDAYHALNAEFAKDYEGTWARLAKDNLKWHKPFTQ 63

Query: 64  VLDQSNAPFYKWFEDGELNASYNCLDRNLQNGNADKVAIVFEADDGSVTRVTYRELHGKV 123
            LD+SNAPFYKWF DG++N SYNCLD NL+NGNADK A++FE+DDG VTRV+YRELH KV
Sbjct: 64  TLDESNAPFYKWFADGQVNVSYNCLDVNLENGNADKTAVIFESDDGKVTRVSYRELHQKV 123

Query: 124 CRFANGLKALGIRKGDRVVIYMPMSVEGVVAMQACARLGATHSVVFGGFSAKSLQERLVD 183
           C+FANGLK+LGI+KGDRVVIYMPMSVEGV AMQACAR+GATHSVVFGGFSAKSL ER++D
Sbjct: 124 CQFANGLKSLGIKKGDRVVIYMPMSVEGVAAMQACARIGATHSVVFGGFSAKSLHERVID 183

Query: 184 VGAVALITADEQMRGGKALPLKAIADDALALGGCEAVRNVIVYRRTGGKVAWTEGRDRWM 243
            GAVA++TAD Q+RGGK LPLK+I D+AL +GGC+ +++V+VY+R G ++ W EGRD W+
Sbjct: 184 AGAVAVLTADYQVRGGKQLPLKSIVDEALDMGGCDTLKHVVVYKRAGAEINWVEGRDLWL 243

Query: 244 EDVSAGQPDTCEAEPVSAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMKWTFDIKP 303
            DV A Q DTCE E V AEHPLF+LYTSGSTGKPKGVQH++ GYLLWA++TMKWTFDIKP
Sbjct: 244 SDVVANQSDTCEPEWVDAEHPLFILYTSGSTGKPKGVQHASAGYLLWAVLTMKWTFDIKP 303

Query: 304 DDLFWCTADIGWVTGHTYIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIARHKVSIFYTA 363
           DD++WCTADIGW+TGHTYIAYGPLA GATQ+VFEGVPTYPNAGRFWDM+ARHK +IFYTA
Sbjct: 304 DDVYWCTADIGWITGHTYIAYGPLAVGATQIVFEGVPTYPNAGRFWDMVARHKATIFYTA 363

Query: 364 PTAIRSLIKAAEADEKIHPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGNERCPIVDTF 423
           PTAIRSLIKAA+ADEK+HPKQYDLSSLR+LG+VGEPINPEAWMWYYKN+G+E CPIVDTF
Sbjct: 364 PTAIRSLIKAADADEKVHPKQYDLSSLRILGSVGEPINPEAWMWYYKNVGHENCPIVDTF 423

Query: 424 WQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGHDVPNGNGGILVVKRPWPAM 483
           WQTETGGHMI+PLPGATP VPGSCTLPLPGI AAIVDETG+D+PNGNGGILVVKRPWP+M
Sbjct: 424 WQTETGGHMISPLPGATPQVPGSCTLPLPGITAAIVDETGNDIPNGNGGILVVKRPWPSM 483

Query: 484 IRTIWGDPERFRKSYFPEELGGKLYLAGDGSIRDKDTGYFTIMGRIDDVLNVSGHRMGTM 543
           IRTIW DPERF+KSYFPEELGGK+YLAGDG++R+K+TGYFTI GRIDDVLNVSGHRMGTM
Sbjct: 484 IRTIWNDPERFKKSYFPEELGGKIYLAGDGAVRNKETGYFTITGRIDDVLNVSGHRMGTM 543

Query: 544 EIESALVSNPLVAEAAVVGRPDDMTGEAICAFVVLKRSRPTGEEAVKIATELRNWVGKEI 603
           EIESALV+N +VAEAAVVG+PD+ TGE+ICAFVVLKR RPTG+EA +IA ELR+WV KEI
Sbjct: 544 EIESALVANSIVAEAAVVGKPDETTGESICAFVVLKRPRPTGDEAKQIAKELRDWVAKEI 603

Query: 604 GPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEEITQDTSTLENPAILEQLKQAQ 660
           GPIAKPK+IRFGDNLPKTRSGKIMRRLLR LAKGE ITQD STLENPAIL+QLK+AQ
Sbjct: 604 GPIAKPKEIRFGDNLPKTRSGKIMRRLLRVLAKGEAITQDVSTLENPAILDQLKEAQ 660


Lambda     K      H
   0.319    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1529
Number of extensions: 64
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 660
Length of database: 660
Length adjustment: 38
Effective length of query: 622
Effective length of database: 622
Effective search space:   386884
Effective search space used:   386884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory