Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate HSERO_RS05415 HSERO_RS05415 spermidine/putrescine ABC transporter ATPase
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__HerbieS:HSERO_RS05415 Length = 362 Score = 255 bits (652), Expect = 1e-72 Identities = 140/296 (47%), Positives = 184/296 (62%), Gaps = 21/296 (7%) Query: 17 LVQLAGIRKCFDGKE-VIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIM 75 LVQ G++K +DG+ ++ LDL I GEFLTLLGPSG GKTT L ++AG E G I Sbjct: 7 LVQFCGVKKTYDGENLIVKNLDLDIRRGEFLTLLGPSGSGKTTCLMMLAGFEFPTGGEIR 66 Query: 76 LDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMV 135 LD + + VP R + VFQ+YALFPHMT+ +NVA+ L ++K A +V +AL MV Sbjct: 67 LDGQLLNRVPPHKRNIGMVFQNYALFPHMTIAQNVAYPLSVRKMDRATREAKVKQALDMV 126 Query: 136 QLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQR 195 Q+ F R P QLSGGQQQRVA+AR +V P+L+L+DE L ALD +LR+ MQ ELKAL + Sbjct: 127 QMGKFGDRYPTQLSGGQQQRVALARTLVFDPQLVLMDEPLGALDKQLREHMQLELKALHK 186 Query: 196 KLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFN 255 +LG+TFV+VTHDQ EALTMSDR+ V G I+Q E+YE P N FVA FIG+ N F Sbjct: 187 RLGVTFVYVTHDQSEALTMSDRVAVFDQGVIQQLAPVTELYEYPDNQFVANFIGDNNRFK 246 Query: 256 ATVIERLDEQRVRANVEGRECNIYVN----------FAVEPGQKLHVLLRPEDLRV 301 +V +V+G C + + GQ + +RPE +R+ Sbjct: 247 GSV----------ESVQGEHCTVRLTDGAALTGLNVHRAHAGQSITACVRPERIRL 292 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 362 Length adjustment: 30 Effective length of query: 348 Effective length of database: 332 Effective search space: 115536 Effective search space used: 115536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory