Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate HSERO_RS11145 HSERO_RS11145 sulfate ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__HerbieS:HSERO_RS11145 Length = 359 Score = 235 bits (599), Expect = 2e-66 Identities = 144/354 (40%), Positives = 206/354 (58%), Gaps = 19/354 (5%) Query: 10 AKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFE 69 A T + L +R + K + A+D VSL + +GE+ LLG SGCGK+TLLR +AG E Sbjct: 3 AATEEDAAVFLSVREVEKRFGSFTALDRVSLEVRRGEMVCLLGPSGCGKTTLLRTIAGLE 62 Query: 70 QPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASR 129 + +G++ DG D+SQ+PP R ++FQSYALFP+++V N+A+GL ++ + + R Sbjct: 63 RQDSGRLHADGRDISQLPPQARDYGILFQSYALFPNLSVADNVAYGL--GRMSRQQKRER 120 Query: 130 VNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQ 189 V EML +V + + P QLSGGQ+QRVALAR+LA P LLLLDEP+ ALD ++R+ +Q Sbjct: 121 VTEMLSMVGLDGSQDKYPGQLSGGQQQRVALARALAPSPSLLLLDEPLSALDAQVREHLQ 180 Query: 190 LEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEF 249 LE+ + ++ +T +MVTHDQEEAM MA RIA+M G+ Q G PE+IY P T + A+F Sbjct: 181 LEIRRLQKQFRITTLMVTHDQEEAMVMADRIAVMQHGRIEQFGTPEQIYRRPATPFVADF 240 Query: 250 IGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPP 309 IG N L + G + GL L++ D S D + RPE + L + Sbjct: 241 IGQAN----WLPFTRLSGSQVAVGGL--HLEIQPDES--DRASGRLFCRPEAVQLFSDES 292 Query: 310 ANGCNFAVGEVIHIAYLGDLSVYHVRLKS----GQMISAQLQN-AHRHRKGLPT 358 N + V+ YLGD Y + L + GQ + A + + AH L T Sbjct: 293 C--ANRFLARVVDRIYLGDR--YRLALAADALPGQTLLADVSSQAHERVASLDT 342 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 359 Length adjustment: 30 Effective length of query: 347 Effective length of database: 329 Effective search space: 114163 Effective search space used: 114163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory