Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate HSERO_RS22750 HSERO_RS22750 sugar ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__HerbieS:HSERO_RS22750 Length = 377 Score = 256 bits (655), Expect = 6e-73 Identities = 139/318 (43%), Positives = 203/318 (63%), Gaps = 8/318 (2%) Query: 18 VQLAGIRKCFDGK-EVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIML 76 V + +RK +DG+ +V+ L+L I +GEF L+GPSGCGK+T+LR++ GLE + G + + Sbjct: 4 VNIKQLRKTYDGRADVLAGLNLDIRDGEFCVLVGPSGCGKSTLLRMLCGLEEISGGELAI 63 Query: 77 DNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQ 136 + + H+P R + VFQSYAL+PHM V++N+AFGL++ ++I R+ A +++ Sbjct: 64 GGQVVNHLPPAERGIAMVFQSYALYPHMNVYKNMAFGLKVAGNSKSDIDARIRHAAAILK 123 Query: 137 LETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRK 196 ++ QR P +LSGGQ+QRVAI RA+V +PRL L DE LS LD LR Q + E+ L R+ Sbjct: 124 IDHLLQRLPRELSGGQRQRVAIGRAIVRQPRLFLFDEPLSNLDAALRVQTRLEIAKLHRQ 183 Query: 197 LGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINM-FN 255 L T V+VTHDQ EA+T+ D+IVVM +GRI+Q GTP E+Y++P+NLFVAGFIG M F Sbjct: 184 LAATIVYVTHDQVEAMTLGDKIVVMHEGRIQQAGTPLELYQQPQNLFVAGFIGSPKMNFF 243 Query: 256 ATVIERLDEQRVRANVEG--RECNIYVNFAVEPGQKLHVLLRPEDLRVEEINDDNHAEGL 313 V+ R D+ V+ + G R V PG + + LR E +R E + D G+ Sbjct: 244 QGVVTRCDDSGVQVEIAGGLRLLADVDPLGVTPGAAVTLGLRAEQIR-EGLGDGQPLHGV 302 Query: 314 IGYVR---ERNYKGMTLE 328 + V E N+ +TL+ Sbjct: 303 VNLVEHLGEANFLYVTLD 320 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 377 Length adjustment: 30 Effective length of query: 348 Effective length of database: 347 Effective search space: 120756 Effective search space used: 120756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory