GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuB in Herbaspirillum seropedicae SmR1

Align Gamma-glutamylputrescine oxidoreductase; Gamma-Glu-Put oxidase; Gamma-glutamylputrescine oxidase; EC 1.4.3.- (characterized)
to candidate HSERO_RS01275 HSERO_RS01275 FAD-dependent oxidoreductase

Query= SwissProt::P37906
         (426 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS01275 HSERO_RS01275
           FAD-dependent oxidoreductase
          Length = 425

 Score =  195 bits (495), Expect = 3e-54
 Identities = 136/406 (33%), Positives = 202/406 (49%), Gaps = 17/406 (4%)

Query: 28  CDVCVVGGGYTGLSSALHLAEAGFDVVVLEASRIGFGASGRNGGQLVNSYSRDIDVIEKS 87
           CDV VVGGG TG ++AL LA  G  VVV EA  +G  ASGRNGG   N +++D   + + 
Sbjct: 27  CDVVVVGGGITGSAAALALARKGARVVVCEADIVGGAASGRNGGMCNNGFAQDYATLSQR 86

Query: 88  YGMDTARMLGSMMFEGGEIIRERIKRYQIDCDY-RPGGLFVAMNDKQLATLEEQKENWER 146
            G++ A  L      G + +   ++   IDC + R G L +A   + +  L   +E   R
Sbjct: 87  LGVEWANRLYRAFDAGVDTVERLVREESIDCSFARHGKLKLAAKPEHVDKLARSQELLAR 146

Query: 147 YGNKQLELLDANAIRREVASDRYTGALLDHSGGHIHPLNLAIGEADAIRLNGGRVYELSA 206
           + +    LL    +R E+ SDRY G LL H    +H      G A A +  G    E + 
Sbjct: 147 HVDGDTRLLSRAQLRDELGSDRYHGGLLMHKSAGMHVGRYVRGLAQAAQRRGALYLERTP 206

Query: 207 VTQIQHTTPA-VVRTAKGQVTAKYVIVAGNAYLGDKVEP--ELAKRSMPCGTQVITTERL 263
           V  I+       VRT+ G + A  V++A       +V P   + +R +P G  +I TE L
Sbjct: 207 VLGIEAKNGRYAVRTSAGVLHAGQVLLASGI---SQVGPFGWIRRRIVPVGAFLIVTEPL 263

Query: 264 SEDLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGGGVVYGARDPDDVER---LVVPKL 320
              L + L+P      D    ++Y+R T D RLL+GG   + A +P    R   ++  ++
Sbjct: 264 PGALLKQLLPTQRMYTDTKNFVNYFRATPDQRLLFGGRARFAASNPQSDARSGEILRAQM 323

Query: 321 LKTFPQLKGVKIDYRWTGNFLLTLSRMPQFGRLDTNIYYMQGYSGHGVTCTHLAGRLIAE 380
           L+ FP L   +IDY W G   +T  R+P+ G+ D  +YY  GYSGHG     L G ++AE
Sbjct: 324 LEVFPALAQTRIDYCWGGMVDMTTDRLPRAGQRD-GLYYSMGYSGHGTHMATLMGSMMAE 382

Query: 381 LLRGDAERFDAFANLPHYPFPG--GRTLRVPFTAMGAAYYSLRDRL 424
           ++ G AE  + + +      PG  G+   +PF     A+Y L+DRL
Sbjct: 383 IMDGHAE-LNPWKDFDWPAIPGHFGKPWFLPFV---GAWYRLKDRL 424


Lambda     K      H
   0.320    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 475
Number of extensions: 25
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 426
Length of database: 425
Length adjustment: 32
Effective length of query: 394
Effective length of database: 393
Effective search space:   154842
Effective search space used:   154842
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory