Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= uniprot:B2T9V8 (351 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 145 bits (365), Expect = 2e-39 Identities = 105/328 (32%), Positives = 168/328 (51%), Gaps = 15/328 (4%) Query: 22 ALPASRGKRARSELARLRELALLPA---LALLIVIGAFI---SPSFLTKANLISVLGASA 75 ALPA+ A S AR R L P LA L+V+ + S +F T +N +VL + Sbjct: 7 ALPAASLHTAAS--ARWRSLIHSPLALPLAGLVVVSLLMGLASDNFFTLSNWFNVLRQVS 64 Query: 76 ALALVVLAESLIVLTGKFDLSLESTVGIAPAVGAMLVMPAASAGFGMQWPAAAGLLAIVV 135 + ++ + S ++LTG DLS+ + + +A + A L++ + PA LL V Sbjct: 65 IVGILAVGMSFVILTGGIDLSVGAAMALAGTISAGLIVNSGL-------PAPLALLCGVG 117 Query: 136 VGAVIGFINGFLVVRLRLNAFIVTLAMLIVLRGMLVGATKGGTLFDMPTSFFALATTIVL 195 + IG +NG LV R+ A IVTLA + V RG+ + + G + +P + Sbjct: 118 LATCIGLLNGALVAWGRMPAIIVTLATMGVARGVGLIYSGGYPISGLPGWISWFGVGRIG 177 Query: 196 GLPLSVWLAAAAFAIAAFMLRYHRLGRALYAIGGNPEAARAAGIRVERITWGVFVLGSIL 255 +P+ V L +A+A +L+ GR +YAIGGN AAR +G++ RI V+ + Sbjct: 178 MVPVPVILMLIVYALAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYAISGFT 237 Query: 256 ASVGGLIVTGYVGAINANQGNGMIFTVFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQN 315 + + +I+TG + + N G G AA V+GG ++ GG+G + G L G +LLG++ N Sbjct: 238 SGLAAIILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLLGILNN 297 Query: 316 LLTLAQVPSFWIQAIYGAIILGSLMVAR 343 L L + + I G IIL ++ +AR Sbjct: 298 GLNLMGINPYLQDIIRGVIILLAIYIAR 325 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 328 Length adjustment: 28 Effective length of query: 323 Effective length of database: 300 Effective search space: 96900 Effective search space used: 96900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory