Align L-2-keto-3-deoxyrhamnonate 4-dehydrogenase subunit (EC 1.1.1.401) (characterized)
to candidate HSERO_RS05065 HSERO_RS05065 2-keto-4-pentenoate hydratase
Query= metacyc::MONOMER-16233 (285 letters) >FitnessBrowser__HerbieS:HSERO_RS05065 Length = 327 Score = 56.2 bits (134), Expect = 9e-13 Identities = 50/165 (30%), Positives = 75/165 (45%), Gaps = 14/165 (8%) Query: 85 PIP---TEPMMFMKALSSLNGPNDEVVLPKNSTHGDWEVELGVVIGETCRFVSEDEALSK 141 PIP T P+M+ A GP +V LP D+E E GV++G V +AL Sbjct: 103 PIPHFDTVPVMYQGASDDFLGPYQDVALPSEEDGIDFEGEFGVIVGPVPMGVQASQALQA 162 Query: 142 VAGYVLVNDVSERF---NQKQRGTQWSKGKGHDTFCPVGPWLVTPDEVGD---PQDLDMH 195 V V +ND S R ++ + G + + K F P+ VTPDE+G + M Sbjct: 163 VRLLVQINDWSLRALGPHEMKTGFGFLQAKPSTAFAPMA---VTPDELGPAWRDGRVQMR 219 Query: 196 LNV--NGTRMQTGNTKTMIFNVAQLISYVSEYITLYPGDLMITGT 238 L V NG + M F+ +LI++ + L G ++ +GT Sbjct: 220 LQVQWNGQPFGHPHGGEMNFSFGELIAHAARSRRLTAGTVIGSGT 264 Lambda K H 0.316 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 327 Length adjustment: 27 Effective length of query: 258 Effective length of database: 300 Effective search space: 77400 Effective search space used: 77400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory