Align RhaS, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate HSERO_RS05095 HSERO_RS05095 LacI family transcription regulator
Query= TCDB::Q7BSH5 (331 letters) >FitnessBrowser__HerbieS:HSERO_RS05095 Length = 335 Score = 125 bits (314), Expect = 1e-33 Identities = 96/295 (32%), Positives = 144/295 (48%), Gaps = 12/295 (4%) Query: 2 KLAKTLALGVALAVAMMAGTASAKDIKIGLVVKSLGNGFFDAANKGAQEAAKELGGVEVI 61 K A L +A A A K I I VVK G +F+ G +E A GV Sbjct: 5 KSACVLVSALAAVGFASALQAQNKPIDIVTVVKITGISWFNRMEVGVKEFAAANPGVTTR 64 Query: 62 YTGPTSTTAEGQIEVINSLIAQGVDAIAVSANDPDALVPALKKATQRGIKVISWDSGVAP 121 GP + A Q ++ L+A+ VDAIAV + DP L P LK+A RGIKV++ ++ Sbjct: 65 QIGPAQSDAAQQQRLVEDLVAKKVDAIAVVSMDPPTLEPVLKRALDRGIKVVTHEAD-NQ 123 Query: 122 EGRILQLNPSSNELIGKMCLTLAKDHLE---GGKGDFAILSATTTSTNQNIWIDQ-MKKQ 177 + ++ + N G D L G G ++ L + S +Q W D Sbjct: 124 KNTLVDIEAFDNTAYGARL----NDRLAACMGQAGKWSSLVGSLGSQSQVQWADGGAANA 179 Query: 178 LKDFPGLNLVTTVYGD-DLSDKSYREAEGLLKSNPNVKVIVAPTTVGVLAASKVVEDKGL 236 K +P + LV + ++K+Y +A+ +L+ +P++K +++ VL + VE+ GL Sbjct: 180 AKKYPKMTLVDAKNESANDAEKAYAKAKEILRKHPDIKGFQGSSSLDVLGIGRAVEEAGL 239 Query: 237 VGKVYVTGLGLPSEMAGAIKSGATKEFAIWNPIDLGYSATQIAYRLVKGE--TDG 289 GKV V G GLPSE A ++SGA A W+P D G + + A LV+G+ TDG Sbjct: 240 QGKVCVYGTGLPSEAAKFLESGAVGGIAFWDPKDAGLAMNKAAMMLVQGKKITDG 294 Lambda K H 0.313 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 335 Length adjustment: 28 Effective length of query: 303 Effective length of database: 307 Effective search space: 93021 Effective search space used: 93021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory