Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate HSERO_RS05195 HSERO_RS05195 xylose ABC transporter ATP-binding protein
Query= TCDB::Q7BSH4 (512 letters) >FitnessBrowser__HerbieS:HSERO_RS05195 Length = 518 Score = 372 bits (954), Expect = e-107 Identities = 206/505 (40%), Positives = 319/505 (63%), Gaps = 15/505 (2%) Query: 20 ILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNE--GEI 77 ILEMRGI + FPGVKAL+NV++A+ G + A++GENGAGKSTL+K+L+G+Y G+I Sbjct: 4 ILEMRGIEKSFPGVKALNNVNLAVREGEIHAIVGENGAGKSTLMKVLSGVYPHGSYSGDI 63 Query: 78 LVDGRPTTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTRFRTIDWQTMNSR 137 + G F + + G+ IHQE L L+V EN+FLG+ + R IDW+ R Sbjct: 64 VYKGEVRAFKDIRDSEHLGIIIIHQELALVPLLSVMENLFLGNE-QARGGVIDWEQSYVR 122 Query: 138 SKALLTALESNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAALSRKEIDDLF 197 +K LL + P ++ DL + ++ L+ IA+ALS E +++I+DEPTA+L+ + D L Sbjct: 123 AKELLAKVGLKESPLTQVGDLGVGKQQLIEIAKALSKEVKLLILDEPTASLNESDSDALL 182 Query: 198 RIVRGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTP--QDEIVRMMV 255 ++ LK QG A + ISHK +E+ ++AD V R R P +D I++ MV Sbjct: 183 ELLLELKRQGIASILISHKLNEISKVADSITVL-RDGTTVDTFDCRAEPISEDRIIQHMV 241 Query: 256 GRDVENVFPKIDVAIGGPVLEIRNY-------SHRTEFRDISFTLRKGEILGVYGLIGAG 308 GR++ + +P+ D IG + E+R++ + R +D++ ++R GEI+G+ GL+GAG Sbjct: 242 GREMADRYPQRDPQIGEVIFEVRDWRVHHPLHTDRLAIKDVNMSVRAGEIVGIAGLMGAG 301 Query: 309 RSELSQSLFGIT--KPLSGKMVLEGQEITIHSPQDAIRAGIVYVPEERGRHGLALPMPIF 366 R+EL++S+FG K ++G+ L G+E+ + + + AI GI YV E+R GL L I Sbjct: 302 RTELAKSIFGRAYGKKITGQAFLHGKEVDLSTIEKAIAKGIAYVTEDRKGDGLVLEEDIK 361 Query: 367 QNMTLPSLARTSRRGFLRAANEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGKW 426 +N++L +L S R + A E+ +A + +++ +R +++ V LSGGNQQKVV+ KW Sbjct: 362 KNISLANLGGVSERTVIDEAREYKIAADFKQQMRIRCSSVLQKVVNLSGGNQQKVVLSKW 421 Query: 427 LATAPKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMK 486 L + P+V+ILDEPT+GID+G+K ++ IS+LAAEG IIM+SSE+PE++GM DR+ VM Sbjct: 422 LFSQPEVLILDEPTRGIDVGAKFEIYNIISKLAAEGKCIIMISSEMPELLGMCDRIYVMN 481 Query: 487 EGLSAGIFERAELSPEALVRAATGN 511 EG G +AE + E ++RA N Sbjct: 482 EGQFVGHLPKAEATQENIMRAIMRN 506 Lambda K H 0.320 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 620 Number of extensions: 34 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 512 Length of database: 518 Length adjustment: 35 Effective length of query: 477 Effective length of database: 483 Effective search space: 230391 Effective search space used: 230391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory