GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaT' in Herbaspirillum seropedicae SmR1

Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate HSERO_RS05250 HSERO_RS05250 D-ribose transporter ATP binding protein

Query= TCDB::Q7BSH4
         (512 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS05250 HSERO_RS05250 D-ribose
           transporter ATP binding protein
          Length = 520

 Score =  383 bits (984), Expect = e-111
 Identities = 212/504 (42%), Positives = 317/504 (62%), Gaps = 6/504 (1%)

Query: 9   VTDSKTGDAPAILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTG 68
           V  S +   P ++ +R + + FPGV ALDN    L  G V AL+GENGAGKSTL+KIL+G
Sbjct: 12  VAASSSSSVP-VIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAGKSTLMKILSG 70

Query: 69  IYRPNEGEILVDGRPTTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTRFRT 128
           +Y+ + G+IL+DG+P      + A   G+  IHQE  L + L+ A+NIF+G  PR     
Sbjct: 71  VYQRDSGDILLDGKPVEITEPRQAQALGIGIIHQELNLMNHLSAAQNIFIGREPRKAMGL 130

Query: 129 -IDWQTMNSRSKALLTALESNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAA 187
            ID   +N ++ A+   +  ++DP+  + +L++A++ +V IA+ALS ++R++IMDEPTAA
Sbjct: 131 FIDEDELNRQAAAIFARMRLDMDPSTPVGELTVARQQMVEIAKALSFDSRVLIMDEPTAA 190

Query: 188 LSRKEIDDLFRIVRGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTPQ 247
           L+  EI +LFRI+R L+ QG  I++ISHK DEL +IAD   V  R  +       ++T  
Sbjct: 191 LNNAEIAELFRIIRDLQAQGVGIVYISHKMDELRQIADRVSVM-RDGKYIATVPMQETSM 249

Query: 248 DEIVRMMVGR--DVENVFPKIDVAIGGPVLEIRNYSHRTEFRDISFTLRKGEILGVYGLI 305
           D I+ MMVGR  D E   P  D +    VLE+R  +     RD+SFTLRKGEILG  GL+
Sbjct: 250 DTIISMMVGRALDGEQRIPP-DTSRNDVVLEVRGLNRGRAIRDVSFTLRKGEILGFAGLM 308

Query: 306 GAGRSELSQSLFGITKPLSGKMVLEGQEITIHSPQDAIRAGIVYVPEERGRHGLALPMPI 365
           GAGR+E+++++FG     +G++++ G +  I SP DA+  GI Y+ E+R   GLA+ M +
Sbjct: 309 GAGRTEVARAIFGADPLEAGEIIIHGGKAVIKSPADAVAHGIGYLSEDRKHFGLAVGMDV 368

Query: 366 FQNMTLPSLARTSRRGFLRAANEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGK 425
             N+ L S+ R +R GF+        A+ Y  +L ++  ++      LSGGNQQK+VI K
Sbjct: 369 QANIALSSMGRFTRVGFMDQRAIREAAQMYVRQLAIKTPSVEQQARLLSGGNQQKIVIAK 428

Query: 426 WLATAPKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVM 485
           WL     ++  DEPT+GID+G+K+ ++  +  LA +G +I+M+SSELPE++ MS RVLVM
Sbjct: 429 WLLRDCDILFFDEPTRGIDVGAKSEIYKLLDALAEQGKAIVMISSELPEVLRMSHRVLVM 488

Query: 486 KEGLSAGIFERAELSPEALVRAAT 509
            EG   G   RA+ + E +++ AT
Sbjct: 489 CEGRITGELARADATQEKIMQLAT 512



 Score = 93.2 bits (230), Expect = 2e-23
 Identities = 74/250 (29%), Positives = 121/250 (48%), Gaps = 20/250 (8%)

Query: 273 PVLEIRNYSHR----TEFRDISFTLRKGEILGVYGLIGAGRSELSQSLFGITKPLSGKMV 328
           PV+ +RN   R        +  F L  GE+  + G  GAG+S L + L G+ +  SG ++
Sbjct: 21  PVIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAGKSTLMKILSGVYQRDSGDIL 80

Query: 329 LEGQEITIHSPQDAIRAGIVYVPEERG-RHGLALPMPIFQNMTLPSLARTSRRGFLRAAN 387
           L+G+ + I  P+ A   GI  + +E    + L+    IF       + R  R+      +
Sbjct: 81  LDGKPVEITEPRQAQALGIGIIHQELNLMNHLSAAQNIF-------IGREPRKAMGLFID 133

Query: 388 EFALARKYAE-----RLDLRAAALSVPVGTLSGGNQQKVVIGKWLATAPKVIILDEPTKG 442
           E  L R+ A      RLD+     S PVG L+   QQ V I K L+   +V+I+DEPT  
Sbjct: 134 EDELNRQAAAIFARMRLDMDP---STPVGELTVARQQMVEIAKALSFDSRVLIMDEPTAA 190

Query: 443 IDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEGLSAGIFERAELSPE 502
           ++    A +   I +L A+G+ I+ +S ++ E+  ++DRV VM++G         E S +
Sbjct: 191 LNNAEIAELFRIIRDLQAQGVGIVYISHKMDELRQIADRVSVMRDGKYIATVPMQETSMD 250

Query: 503 ALVRAATGNA 512
            ++    G A
Sbjct: 251 TIISMMVGRA 260


Lambda     K      H
   0.320    0.137    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 589
Number of extensions: 28
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 520
Length adjustment: 35
Effective length of query: 477
Effective length of database: 485
Effective search space:   231345
Effective search space used:   231345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory