Align serine racemase (EC 5.1.1.18) (characterized)
to candidate HSERO_RS01420 HSERO_RS01420 serine/threonine dehydratase
Query= BRENDA::O59791 (323 letters) >FitnessBrowser__HerbieS:HSERO_RS01420 Length = 326 Score = 446 bits (1148), Expect = e-130 Identities = 212/316 (67%), Positives = 263/316 (83%) Query: 7 LPTYDDVASASERIKKFANKTPVLTSSTVNKEFVAEVFFKCENFQKMGAFKFRGALNALS 66 LP++ DV A+ERIK +A++TPVL S T + E A++FFKCENFQ+MGAFKFRGA+NAL+ Sbjct: 10 LPSFADVLLAAERIKPWAHRTPVLRSRTADTELGAQLFFKCENFQRMGAFKFRGAMNALT 69 Query: 67 QLNEAQRKAGVLTFSSGNHAQAIALSAKILGIPAKIIMPLDAPEAKVAATKGYGGQVIMY 126 Q + QRK GV+TFSSGNHAQ AL+A++LGIPA I+MP DAP AKVAAT+GYG +V+ Y Sbjct: 70 QFDATQRKHGVITFSSGNHAQGTALAAQLLGIPAVIVMPQDAPAAKVAATRGYGAEVVTY 129 Query: 127 DRYKDDREKMAKEISEREGLTIIPPYDHPHVLAGQGTAAKELFEEVGPLDALFVCLGGGG 186 DRY +DRE + ++ +T+IPPYDHPHV+AGQGTA EL +E GPLDALFVCLGGGG Sbjct: 130 DRYTEDREAIGARLAAERKMTLIPPYDHPHVMAGQGTATLELLQETGPLDALFVCLGGGG 189 Query: 187 LLSGSALAARHFAPNCEVYGVEPEAGNDGQQSFRKGSIVHIDTPKTIADGAQTQHLGNYT 246 LLSG+ALAAR +P C++YGVEP+AGNDGQQS R G +VHIDTPKTIADGAQTQHLG YT Sbjct: 190 LLSGAALAARALSPACKIYGVEPQAGNDGQQSLRAGQVVHIDTPKTIADGAQTQHLGKYT 249 Query: 247 FSIIKEKVDDILTVSDEELIDCLKFYAARMKIVVEPTGCLSFAAARAMKEKLKNKRIGII 306 F +I+E VDDI TVSDEEL+ ++F+A RMK+VVEPTGCL FAAAR +K++L+ KR+G+I Sbjct: 250 FGVIRELVDDIHTVSDEELVAGMRFFAERMKMVVEPTGCLGFAAARKLKDQLQGKRVGVI 309 Query: 307 ISGGNVDIERYAHFLS 322 ISGGNVD+ + A FL+ Sbjct: 310 ISGGNVDLGKLATFLA 325 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 326 Length adjustment: 28 Effective length of query: 295 Effective length of database: 298 Effective search space: 87910 Effective search space used: 87910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory