Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate HSERO_RS02195 HSERO_RS02195 sugar ABC transporter permease
Query= reanno::BFirm:BPHYT_RS16110 (311 letters) >FitnessBrowser__HerbieS:HSERO_RS02195 Length = 324 Score = 426 bits (1095), Expect = e-124 Identities = 206/298 (69%), Positives = 251/298 (84%), Gaps = 1/298 (0%) Query: 14 QTEKERETRKANSARWLATPSVAVLVLWMAIPLAMTIWFSFSRYNLLNPDLKGFAGFDNY 73 QT R+ R N R + TPSV +L+ WM +PLAMTI+FS +RYNL+ PD GF G +NY Sbjct: 28 QTSPPRKER-FNPIRLMQTPSVLILLAWMIVPLAMTIYFSVNRYNLMAPDQTGFVGLENY 86 Query: 74 KYLASDPSFGPSIGHTLELIISVLVITVVGGVLMAILFDRKFYGQGIARLLAIAPFFVMP 133 +L DP+F PSIG+T LI SVL I+V+GG L+A+LFD+ F G+GIARLL I PFFVMP Sbjct: 87 AFLLQDPAFWPSIGNTALLIGSVLAISVIGGTLLAVLFDQPFRGRGIARLLVIGPFFVMP 146 Query: 134 TVSALIWKNMILHPVYGLIAQGMRAMGMQPIDWFAEYPLTAVIMIVAWQWLPFAFLILFT 193 TV+ALIWKNMI+HPVYG++A MR +G++PIDW AEYP+ +VI+IVAWQW+PFAFLIL T Sbjct: 147 TVAALIWKNMIMHPVYGILAYVMRHLGLEPIDWLAEYPMLSVIIIVAWQWIPFAFLILLT 206 Query: 194 AIQSLDQEQKEAARIDGAGPFSMFFYITLPHLKRAIAVVVMMETIFLLSIFAEIYTTTGG 253 A+QSLD +QKEAA++DGAGP +FFYI LPHLKRAI VV+M+ETIFLLS+FAEI+TTT G Sbjct: 207 ALQSLDTDQKEAAQLDGAGPVRIFFYIVLPHLKRAITVVIMIETIFLLSVFAEIFTTTAG 266 Query: 254 GPGTATTNLSYLIYSLGLQQFDVGLASAGGILAVVLANIVSFFLVRMLAKNLKGEYEK 311 GPGTATTNL++L+YS+GLQQFD+G+ASAGGI AVVLANIVSFFLVRMLA+NLKG EK Sbjct: 267 GPGTATTNLTFLVYSIGLQQFDIGIASAGGIFAVVLANIVSFFLVRMLARNLKGVNEK 324 Lambda K H 0.328 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 324 Length adjustment: 27 Effective length of query: 284 Effective length of database: 297 Effective search space: 84348 Effective search space used: 84348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory