Align ABC transporter for D-sorbitol, permease component 2 (characterized)
to candidate HSERO_RS04860 HSERO_RS04860 sugar ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_1961 (277 letters) >FitnessBrowser__HerbieS:HSERO_RS04860 Length = 278 Score = 154 bits (388), Expect = 3e-42 Identities = 85/275 (30%), Positives = 142/275 (51%), Gaps = 3/275 (1%) Query: 2 MTLKQSRSLQSLLLGTLAWVAALLLFFPIFWMVLTSFKTEIDAFATPPQFIFMPTLENYL 61 M Q +SL LL+ L ++A L+ P++W++ TS KT + + + PTL NY Sbjct: 7 MNNTQDKSLTRLLV-MLLYIAFTLV--PLYWLLNTSLKTNEETLSVFTLWPNAPTLNNYK 63 Query: 62 HIQERSDYFHFAWNSVLISFSATALCMLIAVPAAYSMAFYETKRTKQTLLWMLSTKMLPP 121 I ++ NS++ T + +L+A+PAAY+ + Y K W+L+ +M PP Sbjct: 64 TIFTDPSWYSGYINSIIYVAMNTVMSLLVALPAAYAFSRYRFLGDKHMFFWLLTNRMTPP 123 Query: 122 VGVLMPIYLLAKGAGLLDTRIALIVIYTLINLPIVVWMIYTYFKDIPREILEAARLDGAT 181 L+P + L GL DT IA+ + + L N+P+ VW++ + +PREI E A +DG + Sbjct: 124 AVFLLPFFQLYSTIGLSDTHIAVALAHMLFNVPLAVWILEGFMSGVPREIDETAYIDGFS 183 Query: 182 LGQEMLRVLLPISKGGLASTMLLSMILCWNEAFWSLNLTSSSAAPLTALIASYSSPEGLF 241 + LR+ LP+ K G+ T + W E + LTS +A P++A++ +S G+ Sbjct: 184 FPRFFLRIFLPLIKSGVGVTAFFCFMFSWVELLLARTLTSVNAKPISAIMTRTASAAGMD 243 Query: 242 WAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAV 276 W L+A L P + W + + +G + G V Sbjct: 244 WGILAAAGVLTIVPGALVIWFVRNHIAKGFAMGRV 278 Lambda K H 0.327 0.137 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 277 Length of database: 278 Length adjustment: 25 Effective length of query: 252 Effective length of database: 253 Effective search space: 63756 Effective search space used: 63756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory