Align ABC transporter for D-Sorbitol, permease component 1 (characterized)
to candidate HSERO_RS16730 HSERO_RS16730 sugar ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2942 (279 letters) >FitnessBrowser__HerbieS:HSERO_RS16730 Length = 293 Score = 137 bits (346), Expect = 2e-37 Identities = 82/257 (31%), Positives = 139/257 (54%), Gaps = 5/257 (1%) Query: 27 LLFFPLGWLFLTAFK--TELQAIAVPPLFVFTPTLENFHEVQERSDYLLYAKNSVITSVL 84 +L FP W+ +TAFK EL + + P +V PTL +F ++ + Y + N+VI SV+ Sbjct: 37 VLLFPFYWMVITAFKPDNELLSQSGNPFWVIAPTLAHFKKLLFDTQYPAWLLNTVIVSVV 96 Query: 85 STVLGLMLAAPAAYAMAFFKGKYTKDILMWMLSTKMMPAVGALVPIYVLAQKSHLLDTQL 144 ST L + AAYA+ + + +K + + + ++P +P+ + K L DT+ Sbjct: 97 STFASLAASVFAAYAIERLRFQGSKQVGLGIFLAYLIPPSILFIPLAAIVFKLGLFDTRW 156 Query: 145 ALIIVFALSNLPIMVWMLYSHFKDIPHEILEAARMDGATLWQEVRLVLLPLGMGGLASTG 204 ALI+ + +P W+L +F+ IP+E+ E A +DGAT W+ + ++LPL + GL S G Sbjct: 157 ALILTYPTFLIPFCTWLLMGYFRSIPYELEECALIDGATRWEILVKIILPLAVPGLISAG 216 Query: 205 LLCLVLSWNEAFWSLN-LSAAKAGTLAT-LIASYSSPEGLFWAKLSAASLMAIAPIVVFG 262 + LSWNE ++L +S+++ T+ ++ + W L A +L+ P+ V Sbjct: 217 IFAFTLSWNEFIYALTFISSSEVKTVPVGIVTELVEGDVYHWGALMAGALLGSLPVAVVY 276 Query: 263 WFSQKQLVQGLTFGAVK 279 F + V G+T GAVK Sbjct: 277 SFFVEYYVSGMT-GAVK 292 Lambda K H 0.327 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 293 Length adjustment: 26 Effective length of query: 253 Effective length of database: 267 Effective search space: 67551 Effective search space used: 67551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory