Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate HSERO_RS16715 HSERO_RS16715 sugar ABC transporter ATP-binding protein
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >FitnessBrowser__HerbieS:HSERO_RS16715 Length = 361 Score = 348 bits (893), Expect = e-100 Identities = 194/363 (53%), Positives = 246/363 (67%), Gaps = 11/363 (3%) Query: 1 MASVTLRNIRKAYDENEVMRDINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGDL 60 MASV +R ++K + +++R +++DIADGEF V VGPSGCGKSTL+RM+AGLE+I+GG++ Sbjct: 1 MASVQIRAVKKQFGSTQIIRGVDIDIADGEFTVLVGPSGCGKSTLLRMLAGLEEITGGEI 60 Query: 61 TIDGMRVNDVAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRNAAKI 120 I G VN+V P R IAMVFQ+YALYPHMT+ DNMAF L LA K +D V+ AA I Sbjct: 61 LIGGTVVNNVQPKDRDIAMVFQNYALYPHMTVRDNMAFSLTLAKKDKAFVDERVKKAADI 120 Query: 121 LHIDHLLDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMRLEFARLH 180 L ++ LLDR P+QLSGGQRQRVA+GRAI R P+VFLFDEPLSNLDA LRV+MR E LH Sbjct: 121 LGLNQLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKELH 180 Query: 181 DELKTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAGFIGSPKMN 240 LKTT IYVTHDQ+EAMT+AD+IVV+ G +EQ G P LY PAN FVAGFIGSP MN Sbjct: 181 QRLKTTSIYVTHDQIEAMTMADQIVVMRDGLVEQRGRPLDLYDYPANLFVAGFIGSPAMN 240 Query: 241 FMEGVVQSVTHDGVTVRYETGETQRVAVEPAAVK--QGDKVTVGIRPEHLHVGMAEDGIS 298 F+ ++ G V + G T+ A AA++ G KVT G+RPEHL +G A GI+ Sbjct: 241 FIPATLRR-NATGAEVEFADG-TRVPAPYGAALQGNDGQKVTYGVRPEHLSIGAAGQGIA 298 Query: 299 ARTMAVESLGDAAYLYAESSVAPDGLIARIPPLERHTKGETQKLGATPEH--CHLFDS-A 355 + + VE G +++ I R ERH G + P+H HLFD+ + Sbjct: 299 TKVIVVEPTGADTEVFSRFGDTSLTSIFR----ERHDFGAGDVIHLVPDHSRTHLFDAES 354 Query: 356 GKA 358 GK+ Sbjct: 355 GKS 357 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 361 Length adjustment: 30 Effective length of query: 339 Effective length of database: 331 Effective search space: 112209 Effective search space used: 112209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory