Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate HSERO_RS18940 HSERO_RS18940 sn-glycerol-3-phosphate ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >FitnessBrowser__HerbieS:HSERO_RS18940 Length = 364 Score = 318 bits (815), Expect = 1e-91 Identities = 175/363 (48%), Positives = 227/363 (62%), Gaps = 31/363 (8%) Query: 1 MAYLQLRGIEKFFGEHR----AIKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAID 56 MA + L+ + K +G I GID I GEFIV VGPSGCGKSTLLR++AGLE I Sbjct: 1 MAAIHLKQVRKTYGAGTKAVDVIHGIDAEIADGEFIVMVGPSGCGKSTLLRMVAGLEEIS 60 Query: 57 GGSLMLDGRDITDQPSSKRDLAMVFQSYALYPHMSVYENMSFALKLAKVDKQVIDEKVQN 116 G +++ R + D +RD+AMVFQ+YALYPHM+VY+NM++ LK+ + K ID +VQ Sbjct: 61 SGQIVIGDRVVNDLEPKERDIAMVFQNYALYPHMTVYQNMAYGLKIQGLSKSEIDARVQR 120 Query: 117 AARILNLTQYLQRTPKELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRVEI 176 AA IL L L+RTP++LSGGQRQRVA+GRAIVR P VFLFDEPLSNLDA LR Q R+EI Sbjct: 121 AAAILELGALLERTPRQLSGGQRQRVAMGRAIVRKPAVFLFDEPLSNLDAKLRVQMRLEI 180 Query: 177 AKLHRDLGATTIYVTHDQVEAMTLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQFIGT 236 KLH L T++YVTHDQVEAMTL R++V+ G+ EQ+GTP E+Y +PA FVA FIG+ Sbjct: 181 QKLHASLRTTSLYVTHDQVEAMTLGQRMIVMNRGVAEQIGTPAEVYARPATTFVASFIGS 240 Query: 237 PQMNVV-------------------PVDKLPQPVQQQAPAAPAGAAVGAIGLRPENITVR 277 P MN++ + +LPQP+ A +G+RPE++ Sbjct: 241 PPMNLLQGKLSADGASFEVSKGNASDILRLPQPL------TGAAGQERILGVRPEHLLPI 294 Query: 278 TTG-ATPVGGQVDLIEALGAETLIYVTTPGGAQFVSRQNDRTDLRVGDAVSLDIDASQAH 336 G A + +V+L+EALGAE L++ GG V R +R G + A H Sbjct: 295 LDGSAAQLSLEVELVEALGAELLVHARC-GGQALVLRCPANVQVRTGQRIGASFGAGDVH 353 Query: 337 WFD 339 WFD Sbjct: 354 WFD 356 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 364 Length adjustment: 29 Effective length of query: 321 Effective length of database: 335 Effective search space: 107535 Effective search space used: 107535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory