Align D-sorbitol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate HSERO_RS05330 HSERO_RS05330 glucose dehydrogenase
Query= reanno::acidovorax_3H11:Ac3H11_2940 (244 letters) >FitnessBrowser__HerbieS:HSERO_RS05330 Length = 243 Score = 295 bits (755), Expect = 6e-85 Identities = 140/239 (58%), Positives = 181/239 (75%) Query: 5 RNLQGQVAAITGAASGIGFASAQTMADAGARVVLIDRDEAALAKACATIGPNALPLVLDL 64 ++L G++A ITGAASGIG A+ + + G VV++D + AL + A +GP +P V +L Sbjct: 3 QSLAGKIAVITGAASGIGLATTEKLLANGVTVVMVDWNAKALDELAARLGPQVIPQVTNL 62 Query: 65 LDARQCASLLQRTLALAGQLDIFHANAGLYVGGDLVDADPDAIDRMLNLNVNVVMKNVHN 124 LDA CA++ L +DI + NAG Y+GG+LVD P+AID+MLNLNVN VMKNVH Sbjct: 63 LDAESCAAMAPEILKKVDHIDILYCNAGTYIGGELVDTTPEAIDKMLNLNVNAVMKNVHA 122 Query: 125 VLPHMIERGTGDIIVTSSLAAHFPTPWEPVYASSKWAVNCFVQTVRRQVFKHGIRVGSIS 184 V PHM+ER +GDIIVT S+A HFPT WEPVYA SKWA+ CFVQT+RRQ+ HG+RVG +S Sbjct: 123 VAPHMMERKSGDIIVTCSVAGHFPTYWEPVYAGSKWAITCFVQTMRRQMIPHGVRVGQVS 182 Query: 185 PGPVITSLLADWPAEKLAEAKASGSLIEAAEVAEVVLFMLTRPRGMTIRDVVMMPTNFD 243 PGPVI++LLADWP E L +AK SGSLIE +EVA+ V +MLTR R +TIRD++++PTNFD Sbjct: 183 PGPVISALLADWPEENLRKAKESGSLIEPSEVADAVEYMLTRNRNVTIRDMLVLPTNFD 241 Lambda K H 0.321 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 243 Length adjustment: 24 Effective length of query: 220 Effective length of database: 219 Effective search space: 48180 Effective search space used: 48180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory