Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate HSERO_RS12375 HSERO_RS12375 3-oxoacyl-ACP reductase
Query= metacyc::MONOMER-13092 (266 letters) >FitnessBrowser__HerbieS:HSERO_RS12375 Length = 261 Score = 92.4 bits (228), Expect = 9e-24 Identities = 79/266 (29%), Positives = 125/266 (46%), Gaps = 40/266 (15%) Query: 9 GKTVIVTGASSGIGKAIVDELLS--LKVKVANFDLTDNGEKHENL-----LFQKVDVTSR 61 GK VIVTGA+SGIG+A +V +A+ D G+ ++L ++ DV+ Sbjct: 14 GKVVIVTGAASGIGEATARRFSDEGARVLLADRDAAALGKVFDSLPPERTAARETDVSHH 73 Query: 62 EQVEASVAAVVEHFGTVDAVVNNAGI----NIPRLLVDPKDPHGQYELDDATFEKITMIN 117 EQV V +E FG +D +V++AG+ N+ V P+D H ++ N Sbjct: 74 EQVRQLVDFAIERFGQLDVLVSDAGVFAEGNVTE--VSPEDWH-----------RVQATN 120 Query: 118 QKGL-YLVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKEL 176 G+ Y +A+ L K +G I+N+AS +GL SAY +K AV + TR+ A + Sbjct: 121 VNGVFYGAREALPHL--EKTRGCIVNVASVSGLAADWNLSAYNASKGAVCNLTRAMALDF 178 Query: 177 GKYGVRVVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSE 236 G+ GVR+ + P + +A + L K E I LGR E Sbjct: 179 GRKGVRINAVCPSLTHTAMTADMADDPPL---LDKFAERI----------ALGRGADPLE 225 Query: 237 VADLVAYYISDRSSYITGITTNVAGG 262 +A ++ + S +S++ G+ V GG Sbjct: 226 IAAVITFLASPDASFVNGVNLPVDGG 251 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 261 Length adjustment: 25 Effective length of query: 241 Effective length of database: 236 Effective search space: 56876 Effective search space used: 56876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory