Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate HSERO_RS19730 HSERO_RS19730 short-chain dehydrogenase
Query= reanno::Koxy:BWI76_RS22230 (259 letters) >FitnessBrowser__HerbieS:HSERO_RS19730 Length = 264 Score = 101 bits (251), Expect = 2e-26 Identities = 82/256 (32%), Positives = 124/256 (48%), Gaps = 9/256 (3%) Query: 3 QVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSDKATRVAQSINAEYGEGTAWGFGADA 62 + AVV GG +G + LA EG RVA+V K VA +++ G AD Sbjct: 8 KAAVVTGGSLGIGRAVAEALAREGVRVAIVARSKGKLEEVASALSQSTGTEVI-AVAADV 66 Query: 63 TSEASVVALARGVDDIFSRVDLLVYSAGIAKAAFISDFALGDFDRSLQ---VNLVGYFLC 119 ++ V A F R+D+LV A S+ + L+ + +VGY Sbjct: 67 SNTEQVEAAVAQAAQHFGRIDILVNGAAHPGGLVRSEIQHASPEGLLEDINIKVVGYMRF 126 Query: 120 AREFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITV 179 A+ + M R G GRII I +G+ GSK SG LT++L+ L GITV Sbjct: 127 AKAVAPHM-RAGGYGRIINIGGLTGR-GSKQLSGMRNVAI--CHLTKTLSDQLGPDGITV 182 Query: 180 HSLMLGNLLKSPMFQSLLPQYATKLGIPEEQVEQYYIDKVPLKRGCDYQDVLNVLMFYAS 239 + + G ++++P L + A G+ EQVEQ Y P++R +++ +V++F AS Sbjct: 183 NVIHPG-VVETPHIHELYEKEAKLQGLTPEQVEQNYAKATPIRRVLQVEEIADVVLFLAS 241 Query: 240 PQASYCTGQSINVTGG 255 P+A+ TG+SI V GG Sbjct: 242 PRAAAITGESIAVDGG 257 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 264 Length adjustment: 25 Effective length of query: 234 Effective length of database: 239 Effective search space: 55926 Effective search space used: 55926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory