Align Fructose import permease protein FruF (characterized)
to candidate HSERO_RS03645 HSERO_RS03645 ribose ABC transporter permease
Query= SwissProt::Q8G846 (356 letters) >FitnessBrowser__HerbieS:HSERO_RS03645 Length = 339 Score = 166 bits (420), Expect = 8e-46 Identities = 107/286 (37%), Positives = 166/286 (58%), Gaps = 10/286 (3%) Query: 30 LLVIICTIFQHDFLALSWNSNTG-GLAGPLITMLQESARYLMIATGMTLVISTAGIDLSV 88 +LV++ +F L LS + + A + +L++ A L++A GMT VI TAGIDLSV Sbjct: 32 VLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSV 91 Query: 89 GSVMAVAGAAAMQTLSNGMNVWLSILIALAVGLAIGCVNGALVSFLGLQPFITTLIMMLA 148 GSV+AV+ MQ W +I + + GL +G VNGA+V+ L + F+ TL M A Sbjct: 92 GSVLAVSAVLGMQVSLGAAPGW-AIPMFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTA 150 Query: 149 GRGMAKVITSGENTDASAVAGNE--PLKWFANGFILGIPANFVIAVIIVILVGLLCRKTA 206 RG A ++ G + V N+ +W NG L +P +AV +V+L ++ RKT Sbjct: 151 FRGAAYLLADG-----TTVLNNDIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTV 205 Query: 207 MGMMIEAVGINQEASRMTGIKPKKILFLVYAISGFLAAIAGLFATASVMRVDVVKTGQDL 266 +GM I A+G N +A+R+TGI+ +L VY+ISG + +AG + + + + G Sbjct: 206 LGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGAN-GNWGSGY 264 Query: 267 EMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITLGVNA 312 E+ AI AVV+GGTSL+GG S+ G+ VGA+II ++ + LG+++ Sbjct: 265 ELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSS 310 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 339 Length adjustment: 29 Effective length of query: 327 Effective length of database: 310 Effective search space: 101370 Effective search space used: 101370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory