Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate HSERO_RS13375 HSERO_RS13375 UTP--glucose-1-phosphate uridylyltransferase
Query= BRENDA::Q8PK83 (297 letters) >FitnessBrowser__HerbieS:HSERO_RS13375 Length = 335 Score = 325 bits (834), Expect = 7e-94 Identities = 167/296 (56%), Positives = 219/296 (73%), Gaps = 2/296 (0%) Query: 3 QRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYK 62 ++I KAVFPVAGLG+RFLPATK PKEMLPI+DKPLIQYAV+EA++AG +IF+T R K Sbjct: 2 KKITKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVEAGITEMIFITGRNK 61 Query: 63 HSIADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAKAV 122 +I D+FDKAYELE +LE AGK++ LE +RH +P + ++V QAE LGLGHAVL AK + Sbjct: 62 RAIEDHFDKAYELESELEAAGKVKLLETIRHVVPKHINCVYVRQAEPLGLGHAVLLAKPL 121 Query: 123 VGNEPFAVLLPDDLM-WNRGDA-ALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA 180 VG+EPFAVLL DD M + G + QM + E G S++AV+DVP +T YGIVS A Sbjct: 122 VGDEPFAVLLADDFMDVDAGQKNVMAQMTAMFEREGKSLLAVQDVPRPETRQYGIVSGSA 181 Query: 181 FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL 240 + R ++ IVEKP PE APS LAVVGRYVL+P IF+ LE G GAGGEIQLTDAI+ L Sbjct: 182 YADRLELMSGIVEKPAPEEAPSTLAVVGRYVLTPAIFERLENIGTGAGGEIQLTDAISAL 241 Query: 241 LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILREALAQADVR 296 L++EQ+ A+R+EG+RFDCG+ +G ++A V +H++ G + L++ AQ D++ Sbjct: 242 LQQEQILAYRYEGQRFDCGSKLGYLKAAVAMGFKHKEVGSGFAQFLQDFAAQHDLQ 297 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 335 Length adjustment: 27 Effective length of query: 270 Effective length of database: 308 Effective search space: 83160 Effective search space used: 83160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate HSERO_RS13375 HSERO_RS13375 (UTP--glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.9739.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-115 370.4 0.0 3.2e-115 370.2 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS13375 HSERO_RS13375 UTP--glucose-1-pho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS13375 HSERO_RS13375 UTP--glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 370.2 0.0 3.2e-115 3.2e-115 1 261 [] 4 268 .. 4 268 .. 0.98 Alignments for each domain: == domain 1 score: 370.2 bits; conditional E-value: 3.2e-115 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDts 68 i kav+P+aGlG r+LPatka+PkemlpivdkPliqy+veeaveaGi+e++++tgr+kraiedhfD++ lcl|FitnessBrowser__HerbieS:HSERO_RS13375 4 ITKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVEAGITEMIFITGRNKRAIEDHFDKA 71 68****************************************************************** PP TIGR01099 69 yeleaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvsee 135 yele++le ++k +ll+++r+++++ ++++yvrq e GLGhavlla++lvgdepfavll+Dd ++ + lcl|FitnessBrowser__HerbieS:HSERO_RS13375 72 YELESELEAAGKVKLLETIRHVVPKhINCVYVRQAEPLGLGHAVLLAKPLVGDEPFAVLLADDFMDVD 139 ***********************998*************************************99765 PP TIGR01099 136 ee...alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlai 200 +++q+++++e+ g+s +av++vp+ e+++YG+++g+ ++l ++ +vekP peeaps la+ lcl|FitnessBrowser__HerbieS:HSERO_RS13375 140 AGqknVMAQMTAMFEREGKSLLAVQDVPRPETRQYGIVSGSAYADRLELMSGIVEKPAPEEAPSTLAV 207 444459************************************************************** PP TIGR01099 201 vGrYvltpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGdklgylka 261 vGrYvltp+ife le++ +G+ggeiqltDa++ ll++e++la++ +g+r+D+G+klgylka lcl|FitnessBrowser__HerbieS:HSERO_RS13375 208 VGRYVLTPAIFERLENIGTGAGGEIQLTDAISALLQQEQILAYRYEGQRFDCGSKLGYLKA 268 ***********************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (335 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 12.87 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory