Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate HSERO_RS00890 HSERO_RS00890 ABC transporter ATP-binding protein
Query= TCDB::P21628 (417 letters) >FitnessBrowser__HerbieS:HSERO_RS00890 Length = 404 Score = 249 bits (635), Expect = 1e-70 Identities = 157/378 (41%), Positives = 209/378 (55%), Gaps = 60/378 (15%) Query: 88 PSTQRWAVLALVVVAFVWPFFASRGA---VDIATLILIYVMLGIGLNIVVGLAGLLDLGY 144 P R ++L L+ + V+PF A + V I + L+Y+ML +GLN+VVG AGLLDLGY Sbjct: 12 PQQARISLLLLLALMIVFPFVAQQFGNSWVRIMDVALLYIMLALGLNVVVGFAGLLDLGY 71 Query: 145 VGFYAVGAYTYALLAE-------------YAGFG-------------------FWTALPI 172 + FYA+GAY+ LLA Y G W +PI Sbjct: 72 IAFYAIGAYSAGLLASPQFAAVIESFVNTYPSVGNFLVWLCGPEIVQNGIHLSLWLIVPI 131 Query: 173 AGMMAALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMT---EITGGPNGIGSIPK 229 + +AALFG LLG P L+LRGDYLAIVTLGFGEIIRI + N+ IT GP GI I Sbjct: 132 SAFLAALFGALLGAPTLKLRGDYLAIVTLGFGEIIRIFMNNLNAPVNITNGPQGINLIDP 191 Query: 230 PTLFGLTFERRAPEGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLALFVINRLMRMPIG 289 +FG++ G + FG++ + V Y + LLL + +F RL +G Sbjct: 192 IKVFGVSLAGEPGSGSMV--KVFGMSMPS---VNAYYFLFLLLCIGVIFFSVRLQDSRLG 246 Query: 290 RAWEALREDEVACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQGLVTPESFTFIESA 349 RAW A+REDE+A +A+G+N VKL AF +GASF G AG+ F A QG V+PESF+ ES Sbjct: 247 RAWVAIREDEIAAKAMGINTRNVKLLAFAMGASFGGVAGAMFGAFQGFVSPESFSLTESI 306 Query: 350 MILAIVVLGGMGSQLGVILAAVVMVLLQE----------MRGFNE-------YRMLIFGL 392 +LA+VVLGG+G GV+L V++ L E M F + R L++GL Sbjct: 307 AVLAMVVLGGIGHIPGVVLGGVILAALPEVLRHVVEPVQMAIFGKVWIDAEVLRQLLYGL 366 Query: 393 TMIVMMIWRPQGLLPMQR 410 M+V+M+ RP GL P R Sbjct: 367 AMVVIMLTRPAGLWPSPR 384 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 417 Length of database: 404 Length adjustment: 31 Effective length of query: 386 Effective length of database: 373 Effective search space: 143978 Effective search space used: 143978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory