Align Hydroxyacylglutathione hydrolase; EC 3.1.2.6; Glyoxalase II; Glx II (uncharacterized)
to candidate HSERO_RS11580 HSERO_RS11580 beta-lactamase
Query= curated2:Q2RP80 (256 letters) >FitnessBrowser__HerbieS:HSERO_RS11580 Length = 291 Score = 73.6 bits (179), Expect = 4e-18 Identities = 61/197 (30%), Positives = 84/197 (42%), Gaps = 37/197 (18%) Query: 18 YLVRCRATGACAVIDPSL-------------AEPVLAAAESLGWTITHILNTHHHYDHTG 64 YLV RA+G CA+ID L A+ ++A LG + IL TH H DH Sbjct: 19 YLVLDRASGQCALIDTVLDYDPKSGRTATTSADQLIARVRELGAQVQWILETHAHADHLS 78 Query: 65 GNEEIKAATGCEII-----------------GFAGDAHRLPGIDRTVVEGDRVAIGQAEA 107 +K G I A AH D+ +G R IGQ +A Sbjct: 79 AAPYLKQQLGGRIAIGEHITQVQAVFGKLFNAGAAFAHDGSQFDQLFADGARFQIGQLQA 138 Query: 108 RVIETPGHTLGHIAYWFAESS--ALFCGDTLFSAGCGR----LFEGSAGQMWDSLRKLRA 161 RV+ TPGHT + Y E+ A F GDTLF G G A ++ S++ + + Sbjct: 139 RVMHTPGHTPACLTYVVEEAGHIAAFVGDTLFMPDYGTARCDFPGGDARTLFRSIQAVLS 198 Query: 162 LPAQTLVFCGHEYTQPN 178 LP ++ H+Y +PN Sbjct: 199 LPDHAQLYMCHDY-RPN 214 Lambda K H 0.322 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 291 Length adjustment: 25 Effective length of query: 231 Effective length of database: 266 Effective search space: 61446 Effective search space used: 61446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory