Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate HSERO_RS13610 HSERO_RS13610 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >FitnessBrowser__HerbieS:HSERO_RS13610 Length = 282 Score = 276 bits (706), Expect = 4e-79 Identities = 143/275 (52%), Positives = 179/275 (65%), Gaps = 3/275 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDH-TPPPVLYWLSGLTCNDENF 59 +E L EH CF G Q +RH S + M FS+F+PP +P PVL++L+GLTC +E F Sbjct: 2 LETLSEHGCFGGVQGYYRHASPAIGLDMRFSVFVPPQASKGSPLPVLFYLAGLTCTEETF 61 Query: 60 TTKAGAQRVAAELGIVLVMPDTSPRGEKVAND-DGYDLGQGAGFYLNATQPPWATHYRMY 118 KAGAQRVAAELG++LV DTSPRG +A + D +D G GAGFYL+ATQ PW+ HYRM Sbjct: 62 MIKAGAQRVAAELGMILVASDTSPRGAGIAGESDSWDFGVGAGFYLDATQAPWSQHYRME 121 Query: 119 DYLRDELPALVQSQFNVS-DRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSV 177 Y+ D+L V F R + GHSMGGHGAL +AL++ Y SVSAFAPI P + Sbjct: 122 SYVVDDLRRAVLDNFPADPQRMGVFGHSMGGHGALTLALRHRDVYRSVSAFAPIAAPINC 181 Query: 178 PWGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAE 237 WG KAFS YLG D+ AW + D+ LM A LIDQG D+FLA+QL P Sbjct: 182 AWGQKAFSHYLGTDRQAWKQHDASELMRALQTPFPQGILIDQGLADKFLAEQLLPERFEA 241 Query: 238 AARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFH 272 A ++ + P++LR GYDH YYFI +F+EDHLRFH Sbjct: 242 ACKEASQPLSLRRHAGYDHGYYFIETFMEDHLRFH 276 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 282 Length adjustment: 26 Effective length of query: 252 Effective length of database: 256 Effective search space: 64512 Effective search space used: 64512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory