Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate HSERO_RS17120 HSERO_RS17120 hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__HerbieS:HSERO_RS17120 Length = 264 Score = 209 bits (531), Expect = 6e-59 Identities = 119/265 (44%), Positives = 162/265 (61%), Gaps = 16/265 (6%) Query: 1 MNLNSIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHV 59 +++ ++PAFDDNY+W+++D GR +VDPGDA PVL A+ A AI LTHHH DHV Sbjct: 1 LDVLAVPAFDDNYLWIIHD--GRYAAVVDPGDAVPVLAALQAEGLTLAAILLTHHHADHV 58 Query: 60 GGVKELVEK-----FPQIVVYGPQETQD--KGTTQVV--KDGETAFVLGHEFSVIATPGH 110 GGV EL + FP I VYGP Q KG T + D VLG VI PGH Sbjct: 59 GGVVELARQAASDTFPIIPVYGPAREQSRIKGMTVPLHGNDQVDIAVLGLRLEVIEVPGH 118 Query: 111 TLGHICYFS--KPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYT 168 T+GHI Y + + LFCGDTLF+GGCGRLFEGT QM SL +L++LP T V CAHEYT Sbjct: 119 TMGHIAYHAPEQAMLFCGDTLFAGGCGRLFEGTPQQMVDSLSRLASLPGQTAVYCAHEYT 178 Query: 169 LSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVI 228 LSN+KFA + P + ++ + + R + + T+P + ERQ N FLR + ++++ + Sbjct: 179 LSNLKFAAEVEPGNAELHARITRERARRERGEPTVPTSIALERQTNPFLRATEKEILDSL 238 Query: 229 NEETLLQQPEE--RFAWLRSKKDRF 251 + L++ +E FA LR K+ + Sbjct: 239 QKAGRLKELDEVSSFAALREWKNSY 263 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 264 Length adjustment: 24 Effective length of query: 227 Effective length of database: 240 Effective search space: 54480 Effective search space used: 54480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate HSERO_RS17120 HSERO_RS17120 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.1770658.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-102 327.8 0.0 2.3e-102 327.6 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS17120 HSERO_RS17120 hydroxyacylglutath Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS17120 HSERO_RS17120 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 327.6 0.0 2.3e-102 2.3e-102 2 248 .] 4 263 .. 3 263 .. 0.95 Alignments for each domain: == domain 1 score: 327.6 bits; conditional E-value: 2.3e-102 TIGR03413 2 iaipalsdNyiwllkdekseavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellek... 66 a+pa++dNy+w+++d + a+vvDpg+a pvl+al+++gl+l+aillTHhHaDHvggv el ++ lcl|FitnessBrowser__HerbieS:HSERO_RS17120 4 LAVPAFDDNYLWIIHDGR-YAAVVDPGDAVPVLAALQAEGLTLAAILLTHHHADHVGGVVELARQaas 70 589**************9.9******************************************876222 PP TIGR03413 67 ..fp.vkvvgpaee..ripgltkevkegdevel..lelevevlevpGHtlgHiayyleeekvlFcgDt 127 fp ++v+gpa+e ri+g+t++++ +d+v++ l+l++ev+evpGHt+gHiay+++e+ +lFcgDt lcl|FitnessBrowser__HerbieS:HSERO_RS17120 71 dtFPiIPVYGPAREqsRIKGMTVPLHGNDQVDIavLGLRLEVIEVPGHTMGHIAYHAPEQAMLFCGDT 138 225699******99999*************9987799******************************* PP TIGR03413 128 LfsaGCGrlfegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealr 195 Lf+ GCGrlfegt++qm++sl++la+Lp +t+vycaHEYtlsNl+Fa++vep n++l++r+++ +a+r lcl|FitnessBrowser__HerbieS:HSERO_RS17120 139 LFAGGCGRLFEGTPQQMVDSLSRLASLPGQTAVYCAHEYTLSNLKFAAEVEPGNAELHARITRERARR 206 ******************************************************************** PP TIGR03413 196 akgkptlPstlaeekatNpFLraeeaevkaalee....ekaeevevfaelRekkdkf 248 ++g+pt+P+++a e++tNpFLra e+e+ +l++ ++ +ev+ fa+lRe+k+++ lcl|FitnessBrowser__HerbieS:HSERO_RS17120 207 ERGEPTVPTSIALERQTNPFLRATEKEILDSLQKagrlKELDEVSSFAALREWKNSY 263 ****************************99999999999999************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (264 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 21.93 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory