Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate HSERO_RS19115 HSERO_RS19115 D-lactate dehydrogenase
Query= BRENDA::H6LBS1 (466 letters) >FitnessBrowser__HerbieS:HSERO_RS19115 Length = 471 Score = 216 bits (550), Expect = 1e-60 Identities = 137/437 (31%), Positives = 225/437 (51%), Gaps = 12/437 (2%) Query: 31 EDFSHDELGSIHSYPEVLIKVTSTEEVSKIMKYAYEHNIPVVVRGSGTGLVGACVPLFGG 90 E DE P+ ++ STEEV+ +K +++ P++ G+GT L G + L GG Sbjct: 38 EHHGRDESSYDPMLPDAVVFAHSTEEVAAFVKLCSQYDTPIIPYGAGTSLEGHVLALQGG 97 Query: 91 IMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVEENDLFYPPDPGEKSATIAGNIST 150 + ++ + MN +L + E+LT TV+ GV +L++ +++ LF+P DPG A++ G ST Sbjct: 98 VTVDLSQMNQVLAVHAEDLTATVQAGVTRKQLNQEIKDTGLFFPIDPGA-DASLGGMAST 156 Query: 151 NAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIVKNSSGYSLKDLVIGSEGTLCVIT 210 A G AV+YG ++ LTVV A GEII+ G + K+S+GY L + +GSEGTL +IT Sbjct: 157 RASGTNAVRYGTMKENTLTLTVVTAQGEIIKTGTRAKKSSAGYDLTRVYVGSEGTLGIIT 216 Query: 211 KAILKLLPLPKMTLSLLIPFENISDAAGIVPKIIKSKAIPTAIEFMERQTI--LFAEDFL 268 + ++L P P+ + + F ++DA V + I+ +E ++ + + A D L Sbjct: 217 EVTVRLYPQPEAISAAICSFPTVADAVNTVIQTIQMGVPLARVELLDENGVRAINAHDKL 276 Query: 269 GKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCLAEGAKDVYIVDTVERKDSVWSAR 328 N +L F G ++ V+ + E V ++ A E + +W+AR Sbjct: 277 SLPV-----NPLLLFEFHG-SENGVKEQAELVQDIAKEFHALGFEWATRPEDRTRLWTAR 330 Query: 329 -GAFLEAIKAST-TEMDECDVVVPRNRIAEFIEFTHDLAKEMDVRIPSFGHAGDGNLHIY 386 A+ ++ D VP +R+AE + T +E + GH GDGN H+ Sbjct: 331 HNAYFALLQLRPGARAISTDCCVPISRLAECVLATKADCEEQGLTHAIIGHVGDGNFHVQ 390 Query: 387 VCRDELCQADWEAKLAEAMDRMYAKALTFEGLVSGEHGIGYAKRKYLLNDFGTEHLALMA 446 + D AD A+ RM A+A+ +G +GEHG+G K +L+ + G +A+M Sbjct: 391 MMVDPNDPAD-IARAEGVNQRMVARAIGMDGTCTGEHGVGLHKMDFLIQEHGEGAIAVMR 449 Query: 447 GIKQTFDPKNLLNPKKV 463 IK DPKN++NP K+ Sbjct: 450 AIKHALDPKNIMNPGKI 466 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 471 Length adjustment: 33 Effective length of query: 433 Effective length of database: 438 Effective search space: 189654 Effective search space used: 189654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory