Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate HSERO_RS02795 HSERO_RS02795 alcohol dehydrogenase
Query= curated2:Q82MN2 (342 letters) >FitnessBrowser__HerbieS:HSERO_RS02795 Length = 386 Score = 89.7 bits (221), Expect = 1e-22 Identities = 91/311 (29%), Positives = 129/311 (41%), Gaps = 51/311 (16%) Query: 1 MKALVKEKAEPGLWLMDVPEPEIGPGD-VLIKVLRTGICGTDLHIRSWDGWAQQAVRTPL 59 M+AL+ A + + VP+P I D V++KV T ICG+DLH+ A + Sbjct: 1 MRALLYHSAHD-VRVETVPDPIIQEADDVILKVTATAICGSDLHLYRGK---IPATKAGD 56 Query: 60 VLGHEFVGEVVETGRDVVDIKAGDRVSGEGHLVCGKCRNCQAGRRHLCRAT--------- 110 +LGHEF+G VVE G + +K GDRV + CG+C C C T Sbjct: 57 ILGHEFMGVVVEAGPAIKRLKKGDRVVVPFVIACGQCFFCDQHLYAACETTNPDRGALMN 116 Query: 111 -------------VGLGVGRDGAFAEYVALPAANVWVHRVP---VDLDVAAIFDPFGNAV 154 L G G AEYV +P A+V R+ D V + D Sbjct: 117 AKGIRSGAAMFGYSHLYGGMPGGQAEYVRVPKADVGPIRIDSALADEQVLFLSDILPTGY 176 Query: 155 HTALSFPL-VGEDVLITGAGPIGLMAAAVARHAGARNVMITDVSEERLELARKIGVSLAL 213 + + G V I GAGP+G MAAA AR GA + + D RL A++ + + Sbjct: 177 QAVKNAGVREGSSVAIYGAGPVGQMAAASARMLGAERIFMVDHHAYRLRFAQEQYDVIPV 236 Query: 214 NVADTTIADGQRALGLREGFD-----IGLEMSG---------------RPEAMRDMIANM 253 N A+ A G D +G E G +A+R IA++ Sbjct: 237 NFDQVDPAEYIIANTAGRGVDGVIDAVGFEAKGSVLETAMTTLKLEGSSGQALRHCIASV 296 Query: 254 THGGRIAMLGL 264 GG I++ G+ Sbjct: 297 RRGGVISVPGV 307 Lambda K H 0.322 0.140 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 386 Length adjustment: 29 Effective length of query: 313 Effective length of database: 357 Effective search space: 111741 Effective search space used: 111741 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory