Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate HSERO_RS01485 HSERO_RS01485 hypothetical protein
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__HerbieS:HSERO_RS01485 Length = 280 Score = 122 bits (305), Expect = 1e-32 Identities = 83/259 (32%), Positives = 129/259 (49%), Gaps = 8/259 (3%) Query: 9 VKLHNGVEMPWFGLGVFKV----ENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGI 64 + L NG +P G G + + N +++A + G IDTA +Y I Sbjct: 7 LSLRNGQSVPILGQGTWNMGESPAQANAEVRALQAGLDLGMSLIDTAEMYAEGGAERIVA 66 Query: 65 KESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWR 124 K R+++++ SKV + T+AA E SL+RL D +DLYL+HW G T Sbjct: 67 KAIAGRRDQVYLVSKVLPHNASKRGTIAACEASLKRLGTDRIDLYLLHWRGAHPLAATIE 126 Query: 125 ALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKP-MVNQVEFH--PRLTQKELRDYCKG 181 +E L GKI GVSNF +++LL++ + + NQV ++ R + +L + Sbjct: 127 GMETLVSQGKIGGWGVSNFDTDDIDDLLEEPHGEHYLCNQVLYNLSRRGIEYDLLPQAQQ 186 Query: 182 QGIQLEAWSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDL-QHGVVTIPKSIKEHRII 240 I + A+SP+ QG++L + LT +A+ H + AQ+ L W L Q GVV IPK+ + Sbjct: 187 AHIAVMAYSPIEQGRILKHPALTALAQAHRVTPAQIALAWVLRQPGVVAIPKAADVAHVQ 246 Query: 241 ENADIFDFELSQEDMDKID 259 N D LS D+ +D Sbjct: 247 ANRASLDISLSAADLKILD 265 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 280 Length adjustment: 25 Effective length of query: 251 Effective length of database: 255 Effective search space: 64005 Effective search space used: 64005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory