Align MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate HSERO_RS16730 HSERO_RS16730 sugar ABC transporter permease
Query= TCDB::Q8DT26 (278 letters) >FitnessBrowser__HerbieS:HSERO_RS16730 Length = 293 Score = 137 bits (346), Expect = 2e-37 Identities = 84/269 (31%), Positives = 147/269 (54%), Gaps = 10/269 (3%) Query: 11 SIYALLILLSFIWLFPIIWVILTSFRGEGTAYVPYIIPKTW----TLDNYIKLFTNSSFP 66 +IY L++ F+ LFP W+++T+F+ + P W TL ++ KL ++ +P Sbjct: 26 TIYIPLLIFLFVLLFPFYWMVITAFKPDNELLSQSGNP-FWVIAPTLAHFKKLLFDTQYP 84 Query: 67 FGRWFLNTLIVSTATCVLSTSITVAMAYSLSRIKFKHRNGFLKLALVLNMFPGFMSMIAV 126 W LNT+IVS + S + +V AY++ R++F+ + + P + I + Sbjct: 85 --AWLLNTVIVSVVSTFASLAASVFAAYAIERLRFQGSKQVGLGIFLAYLIPPSILFIPL 142 Query: 127 YYILKALNLTQTLTSLVLVYSSGAA-LTFYIAKGFFDTIPYSLDESAMIDGATRKDIFLK 185 I+ L L T +L+L Y + ++ G+F +IPY L+E A+IDGATR +I +K Sbjct: 143 AAIVFKLGLFDTRWALILTYPTFLIPFCTWLLMGYFRSIPYELEECALIDGATRWEILVK 202 Query: 186 ITLPLSKPIIVYTALLAFIAPWIDFIFAQVILGDATSKYTVAIGLFSMLQADTINNWFMA 245 I LPL+ P ++ + AF W +FI+A + + K TV +G+ + L + +W A Sbjct: 203 IILPLAVPGLISAGIFAFTLSWNEFIYALTFISSSEVK-TVPVGIVTELVEGDVYHW-GA 260 Query: 246 FAAGSVLIAIPITILFIFMQKYYVEGITG 274 AG++L ++P+ +++ F +YYV G+TG Sbjct: 261 LMAGALLGSLPVAVVYSFFVEYYVSGMTG 289 Lambda K H 0.330 0.142 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 293 Length adjustment: 26 Effective length of query: 252 Effective length of database: 267 Effective search space: 67284 Effective search space used: 67284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory