Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate HSERO_RS16715 HSERO_RS16715 sugar ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__HerbieS:HSERO_RS16715 Length = 361 Score = 323 bits (829), Expect = 4e-93 Identities = 179/380 (47%), Positives = 243/380 (63%), Gaps = 26/380 (6%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M ++++ + K++ + + + ++DI D EF V VGPSGCGKST LRM+AGLE+IT G Sbjct: 1 MASVQIRAVKKQFGSTQ--IIRGVDIDIADGEFTVLVGPSGCGKSTLLRMLAGLEEITGG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 + I ++N+ PKDRDIAMVFQNYALYPHM+V +NMAF L L K K +++RV +AA Sbjct: 59 EILIGGTVVNNVQPKDRDIAMVFQNYALYPHMTVRDNMAFSLTLAKKDKAFVDERVKKAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 +ILGL + L+R P LSGGQRQRVAMGRAIVRD +VFL DEPLSNLDAKLRV MR EI + Sbjct: 119 DILGLNQLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKE 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H+R+ T+IYVTHDQ EAMT+AD+IV+M G +EQ G P +LY+ PAN Sbjct: 179 LHQRLKTTSIYVTHDQIEAMTMADQIVVMRD----------GLVEQRGRPLDLYDYPANL 228 Query: 241 FVAGFIGSPAMNFFEVTVEKE----RLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIR 296 FVAGFIGSPAMNF T+ + + DG + P G +G G+KVT G+R Sbjct: 229 FVAGFIGSPAMNFIPATLRRNATGAEVEFADGTRVPAPYGAAL----QGNDGQKVTYGVR 284 Query: 297 PEDISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKV 356 PE +S + ++V E G+++ ++ +FG T T+ R G+ + Sbjct: 285 PEHLSIGA------AGQGIATKVIVVEPTGADTEVFSRFGDTSLTSIFRERHDFGAGDVI 338 Query: 357 QLTFNIAKGHFFDLETEKRI 376 L + ++ H FD E+ K + Sbjct: 339 HLVPDHSRTHLFDAESGKSL 358 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 361 Length adjustment: 30 Effective length of query: 347 Effective length of database: 331 Effective search space: 114857 Effective search space used: 114857 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory