Align Trehalose transport system permease protein SugA (characterized)
to candidate HSERO_RS13085 HSERO_RS13085 glycerol-3-phosphate transporter permease
Query= SwissProt::P9WG03 (307 letters) >FitnessBrowser__HerbieS:HSERO_RS13085 Length = 294 Score = 108 bits (271), Expect = 1e-28 Identities = 83/285 (29%), Positives = 132/285 (46%), Gaps = 11/285 (3%) Query: 23 RRLAFMLVAPAAMLMVAVTAYPIGYALWLSLQRNNLATP--NDTAFIGLGNYHTILIDRY 80 R +L P +++ +P A+ S L P N + F+GL NY IL D Sbjct: 10 RWFPLLLATPQMLIVFLFFLWPAVKAIAWSFY---LVRPFGNGSRFVGLDNYLRILTDDS 66 Query: 81 WWTALAVTLAITAVSVTIEFVLGLALALVMHRTLIGKGLVRTAVLIPYGIVTVVASYSWY 140 ++ +L TL TA S + + LALA + + K L+R+ + PY + VV Sbjct: 67 FYASLRATLVFTAGSTLLAVTIALALAACLELDVRAKRLLRSIFIWPYAVAGVVVGIVLK 126 Query: 141 YAWTPGTGYLA---NLLPYDSAPLTQQIPSLGIVVIAEVWKTTPFMSLLLLAGLALVPED 197 P TG LA L P AP ++ ++ A W P +L A L +P D Sbjct: 127 VLINPVTGLLAFLNQLWPGVWAPHLIGAQAMLALIAAFAWTQVPLNFILFSAALQRIPAD 186 Query: 198 LLRAAQVDGASAWRRLTKVILPMIKPAIVVALLFRTLDAF-RIFDNIYVLT--GGSNNTG 254 L+ AA +DGA WRR + LPMI PA+++A + ++AF F + LT G +T Sbjct: 187 LMGAAAIDGAGPWRRFIDIQLPMIAPALLLAGVINVIEAFTHGFGLVDALTQGGPGRSTA 246 Query: 255 SVSILGYDNLFKGFNVGLGSAISVLIFGCVAVIAFIFIKLFGAAA 299 ++ Y + F G ++ SA+SV++ + + + ++ F A Sbjct: 247 ILAYQIYSDGFIGLDLSGSSALSVVLMLFIVALTLLQLRFFRQGA 291 Lambda K H 0.326 0.139 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 294 Length adjustment: 27 Effective length of query: 280 Effective length of database: 267 Effective search space: 74760 Effective search space used: 74760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory